Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_000275.1
Subject Sequence ID: ENSG00000131828
Subject Sequence type: 3

Query= gi|4505685|ref|NP_000275.1| pyruvate dehydrogenase (lipoamide)
alpha 1; Pyruvate dehydrogenase, E1-alpha polypeptide-1 [Homo sapiens]
         (390 letters)

>ENSG00000131828
          Length = 15915

 Score =  128 bits (322), Expect = 4e-33
 Identities = 63/81 (77%), Positives = 66/81 (81%), Gaps = 7/81 (8%)
 Frame = +2

Query: 32   NDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC 91
            N+     +KCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC
Sbjct: 5981 NNYLIPFQKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC 6160

Query: 92   HLCDGQ-------EACCVGLE 105
            HLCDGQ       E C +G E
Sbjct: 6161 HLCDGQVSGRFVVELCYLGTE 6223



 Score =  117 bits (292), Expect = 1e-29
 Identities = 54/54 (100%), Positives = 54/54 (100%)
 Frame = +2

Query: 201   QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 254
             QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV
Sbjct: 11414 QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 11575



 Score =  114 bits (284), Expect = 1e-28
 Identities = 54/54 (100%), Positives = 54/54 (100%)
 Frame = +2

Query: 337   EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 390
             EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS
Sbjct: 15557 EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 15718



 Score = 91.3 bits (225), Expect = 7e-22
 Identities = 43/43 (100%), Positives = 43/43 (100%)
 Frame = +2

Query: 97   QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT 139
            QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT
Sbjct: 7346 QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT 7474



 Score = 73.9 bits (180), Expect = 1e-16
 Identities = 38/40 (95%), Positives = 38/40 (95%)
 Frame = +3

Query: 297   PGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK 336
             P  SYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK
Sbjct: 14973 PPHSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK 15092



 Score = 69.3 bits (168), Expect = 3e-15
 Identities = 35/53 (66%), Positives = 38/53 (71%)
 Frame = +2

Query: 171   VPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICE 223
             VPLGAGIALACKYNGKDEVCLTLYGDGAANQ  +   +    L+    IF  E
Sbjct: 10559 VPLGAGIALACKYNGKDEVCLTLYGDGAANQVIMSLNFPKTVLFSKSLIFTVE 10717



 Score = 53.9 bits (128), Expect = 1e-10
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = +1

Query: 278   GPILMELQTYRYHGHSMSDPGVSY 301
             GPILMELQTYRYHGHSMSDPGV Y
Sbjct: 13720 GPILMELQTYRYHGHSMSDPGVRY 13791



 Score = 53.5 bits (127), Expect = 2e-10
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +3

Query: 253   RVDGMDILCVREATRFAAAYCRSGK 277
             +VDGMDILCVREATRFAAAYCRSGK
Sbjct: 11751 QVDGMDILCVREATRFAAAYCRSGK 11825



 Score = 46.2 bits (108), Expect = 2e-08
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +2

Query: 152  SMHMYAKNFYGGNGIVGAQV 171
            SMHMYAKNFYGGNGIVGAQV
Sbjct: 9185 SMHMYAKNFYGGNGIVGAQV 9244



 Score = 41.2 bits (95), Expect = 8e-07
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 20   ASRVLVASRNFANDATFEIK 39
            ASRVLVASRNFANDATFEIK
Sbjct: 5380 ASRVLVASRNFANDATFEIK 5439



 Score = 38.5 bits (88), Expect = 5e-06
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 1   MRKMLAAVSRVLSGASQKP 19
           MRKMLAAVSRVLSGASQKP
Sbjct: 106 MRKMLAAVSRVLSGASQKP 162



 Score = 25.8 bits (55), Expect = 0.034
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = -3

Query: 356  DPEPPLEELGYHIYSSDPPFEVRGANQW 383
            D   P+E LG H++ S  PF     + W
Sbjct: 9229 DAIAPVEVLGIHVHRSSFPFSTTSFSSW 9146



 Score = 19.2 bits (38), Expect = 3.2
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +3

Query: 375  FEVRGANQWIKFKSV 389
            F  RG N+WIKF ++
Sbjct: 7488 FTERG-NEWIKFLNI 7529



 Score = 18.1 bits (35), Expect = 7.1
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = -1

Query: 91   CHLCDGQEAC 100
            C  CD  E+C
Sbjct: 9525 CTACDSTESC 9496



 Score = 17.7 bits (34), Expect = 9.3
 Identities = 6/15 (40%), Positives = 9/15 (60%)
 Frame = -3

Query: 168   GAQVPLGAGIALACK 182
             GA+VP    + L C+
Sbjct: 12448 GAEVPTSETLFLGCR 12404


Lambda     K      H
   0.321    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7168
Number of Sequences: 0
Number of extensions: 108
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of query: 390
length of database: 5305
effective HSP length: 50
effective length of query: 340
effective length of database: 5255
effective search space:  1786700
effective search space used:  1786700
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.6 bits)
S2: 34 (17.7 bits)

END