Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_000483.2
Subject Sequence ID: ENSG00000001626
Subject Sequence type: 3

Query= gi|6995996|ref|NP_000483.2| cystic fibrosis transmembrane
conductance regulator, ATP-binding cassette (sub-family C, member 7);
cystic fibrosis transmembrane conductance regulator; ATP-binding
cassette, sub-family C member 7; CFTR/MRP [Homo sapiens]
         (1480 letters)

>ENSG00000001626
          Length = 188699

 Score =  472 bits (1214), Expect = e-135
 Identities = 241/242 (99%), Positives = 242/242 (100%)
 Frame = +1

Query: 589    SCVCKLMANKTRILVTSKMEHLKKADKILILNEGSSYFYGTFSELQNLQPDFSSKLMGCD 648
              SCVCKLMANKTRILVTSKMEHLKKADKILIL+EGSSYFYGTFSELQNLQPDFSSKLMGCD
Sbjct: 111970 SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCD 112149

Query: 649    SFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSI 708
              SFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSI
Sbjct: 112150 SFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSI 112329

Query: 709    RKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQS 768
              RKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQS
Sbjct: 112330 RKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQS 112509

Query: 769    VLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEED 828
              VLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEED
Sbjct: 112510 VLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEED 112689

Query: 829    LK 830
              LK
Sbjct: 112690 LK 112695



 Score =  176 bits (447), Expect = 6e-46
 Identities = 88/108 (81%), Positives = 96/108 (88%)
 Frame = +1

Query: 866    CLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADT 925
              C+   ++     + + +LL +TPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADT
Sbjct: 123508 CIGNSVSNFGCQITISYLLYSTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADT 123687

Query: 926    LLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGIL 973
              LLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAG +L
Sbjct: 123688 LLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGTLL 123831



 Score =  171 bits (434), Expect = 2e-44
 Identities = 84/84 (100%), Positives = 84/84 (100%)
 Frame = +2

Query: 1157   MRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLT 1216
              MRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLT
Sbjct: 147560 MRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLT 147739

Query: 1217   AKYTEGGNAILENISFSISPGQRV 1240
              AKYTEGGNAILENISFSISPGQRV
Sbjct: 147740 AKYTEGGNAILENISFSISPGQRV 147811



 Score =  149 bits (377), Expect = 8e-38
 Identities = 80/105 (76%), Positives = 87/105 (82%), Gaps = 2/105 (1%)
 Frame = +3

Query: 63    SKKNPKLINALRRCFFWRFMFYG--IFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA 120
             S K+ K    + R F+ + M +   +F  L EVTKAVQPLLLGRIIASYDPDNKEERSIA
Sbjct: 50844 SSKDEKSCVEILRVFYEK*MKFNFSVFPLL*EVTKAVQPLLLGRIIASYDPDNKEERSIA 51023

Query: 121   IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTL 165
             IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKK +
Sbjct: 51024 IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKVI 51158



 Score =  132 bits (331), Expect = 2e-32
 Identities = 63/77 (81%), Positives = 63/77 (81%)
 Frame = +2

Query: 1047   GRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMX 1106
              GRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEM 
Sbjct: 131618 GRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMI 131797

Query: 1107   XXXXXXXXXXXXXLTTG 1123
                           LTTG
Sbjct: 131798 FVIFFIAVTFISILTTG 131848



 Score =  132 bits (331), Expect = 2e-32
 Identities = 63/65 (96%), Positives = 65/65 (100%)
 Frame = +2

Query: 464   KTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKA 523
             +TSLLM+IMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKA
Sbjct: 79499 QTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKA 79678

Query: 524   CQLEE 528
             CQLEE
Sbjct: 79679 CQLEE 79693



 Score =  131 bits (329), Expect = 3e-32
 Identities = 66/66 (100%), Positives = 66/66 (100%)
 Frame = +1

Query: 1415   VIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEE 1474
              VIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEE
Sbjct: 186946 VIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEE 187125

Query: 1475   VQDTRL 1480
              VQDTRL
Sbjct: 187126 VQDTRL 187143



 Score =  130 bits (327), Expect = 5e-32
 Identities = 66/79 (83%), Positives = 69/79 (87%)
 Frame = +3

Query: 397   VTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAV 456
             V  F+ +GFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAV
Sbjct: 68658 VCVFF*QGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAV 68837

Query: 457   AGSTGAGKTSLLMMIMGEL 475
             AGSTGAGK  LL   +  L
Sbjct: 68838 AGSTGAGKVVLLFFTIKNL 68894



 Score =  126 bits (316), Expect = 9e-31
 Identities = 64/83 (77%), Positives = 65/83 (78%)
 Frame = +1

Query: 290   QTELKLTRKAAYVRYXXXXXXXXXXXXXXXXXXLPYALIKGIILRKIFTTISFCIVLRMA 349
             +TELKLTRKAAYVRY                  LPYALIKGIILRKIFTTISFCIVLRMA
Sbjct: 60136 RTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMA 60315

Query: 350   VTRQFPWAVQTWYDSLGAINKIQ 372
             VTRQFPWAVQTWYDSLGAINKIQ
Sbjct: 60316 VTRQFPWAVQTWYDSLGAINKIQ 60384



 Score =  119 bits (298), Expect = 1e-28
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +1

Query: 1321   EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPV 1379
              +VGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPV
Sbjct: 184723 QVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPV 184899



 Score =  113 bits (283), Expect = 6e-27
 Identities = 56/58 (96%), Positives = 57/58 (98%)
 Frame = +2

Query: 193   EGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQ 250
             +GLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYR Q
Sbjct: 55283 QGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYR*Q 55456



 Score =  106 bits (264), Expect = 1e-24
 Identities = 52/52 (100%), Positives = 52/52 (100%)
 Frame = +2

Query: 1240   VGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQ 1291
              VGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQ
Sbjct: 162476 VGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQ 162631



 Score = 94.7 bits (234), Expect = 3e-21
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 829    LKECLFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEV 874
              ++EC FDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEV
Sbjct: 114962 IQECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEV 115099



 Score = 90.5 bits (223), Expect = 6e-20
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = +1

Query: 247   YRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQ 290
             YRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQ
Sbjct: 56581 YRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQ 56712



 Score = 85.9 bits (211), Expect = 1e-18
 Identities = 41/43 (95%), Positives = 42/43 (97%)
 Frame = +1

Query: 13    SKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLER 55
             S L+FSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLER
Sbjct: 24274 SSLYFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLER 24402



 Score = 84.3 bits (207), Expect = 4e-18
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = +3

Query: 55    REWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLG 91
             REWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLG
Sbjct: 29070 REWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLG 29180



 Score = 76.6 bits (187), Expect = 8e-16
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +2

Query: 1380   TYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLV 1415
              TYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLV
Sbjct: 185498 TYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLV 185605



 Score = 70.9 bits (172), Expect = 5e-14
 Identities = 32/33 (96%), Positives = 32/33 (96%)
 Frame = +2

Query: 1292   KVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGL 1324
              KVFIFSGTFRKNLDPYEQWSDQEIWKVADEV L
Sbjct: 172880 KVFIFSGTFRKNLDPYEQWSDQEIWKVADEVRL 172978



 Score = 70.5 bits (171), Expect = 6e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +3

Query: 1013   PYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEG 1047
              PYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEG
Sbjct: 130605 PYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEG 130709



 Score = 69.3 bits (168), Expect = 1e-13
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = +1

Query: 1123   GEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLM 1157
              GEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSL+
Sbjct: 134650 GEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLV 134754



 Score = 67.4 bits (163), Expect = 5e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 373   DFLQKQEYKTLEYNLTTTEVVMENVTAFWEE 403
             DFLQKQEYKTLEYNLTTTEVVMENVTAFWEE
Sbjct: 62054 DFLQKQEYKTLEYNLTTTEVVMENVTAFWEE 62146



 Score = 64.3 bits (155), Expect = 4e-12
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +2

Query: 529    DISKFAEKDNIVLGEGGITLSGGQRARISLAR 560
              DISKFAEKDNIVLGEGGITLSGGQRARISLAR
Sbjct: 107777 DISKFAEKDNIVLGEGGITLSGGQRARISLAR 107872



 Score = 63.2 bits (152), Expect = 1e-11
 Identities = 31/34 (91%), Positives = 31/34 (91%)
 Frame = +1

Query: 558    LARAVYKDADLYLLDSPFGYLDVLTEKEIFESCV 591
              L RAVYKDADLYLLDSPFGYLDVLTEKEIFE  V
Sbjct: 110383 LFRAVYKDADLYLLDSPFGYLDVLTEKEIFERYV 110484



 Score = 58.9 bits (141), Expect = 2e-10
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = +2

Query: 164   TLKLSSRVLDKISIGQLVSLLSNNLNKFDE 193
             TLKLSSRVLDKISIGQLVSLLSNNLNKFDE
Sbjct: 54314 TLKLSSRVLDKISIGQLVSLLSNNLNKFDE 54403



 Score = 53.1 bits (126), Expect = 1e-08
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +3

Query: 970    GGILNRFSKDIAILDDLLPLTIFDF 994
              GGILNRFSKDIAILDDLLPLTIFDF
Sbjct: 126711 GGILNRFSKDIAILDDLLPLTIFDF 126785



 Score = 39.7 bits (91), Expect = 1e-04
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +1

Query: 526    LEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLD 579
              L   I +F  K + VL +GG  LS G +  + LAR+V   A + LLD P  +LD
Sbjct: 184732 LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLD 184893



 Score = 35.8 bits (81), Expect = 0.002
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 1   MQRSPLEKASVVSKLFF 17
           MQRSPLEKASVVSKLFF
Sbjct: 133 MQRSPLEKASVVSKLFF 183



 Score = 30.0 bits (66), Expect = 0.089
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = +2

Query: 866    CLVIFLAEVAASLVVLWLLG 885
              CLV F  +VAASLVVLWLLG
Sbjct: 122846 CLVPF--QVAASLVVLWLLG 122899



 Score = 24.6 bits (52), Expect = 3.7
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 1328   IEQFPGKLDFVLVDGGCVLSHGHKQLMCLAR 1358
              I +F  K + VL +GG  LS G +  + LAR
Sbjct: 107780 ISKFAEKDNIVLGEGGITLSGGQRARISLAR 107872



 Score = 23.5 bits (49), Expect = 8.4
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -1

Query: 1452  HRNSSKCKSKPQ 1463
             H +S KCKSKPQ
Sbjct: 34949 H*SSDKCKSKPQ 34914


Lambda     K      H
   0.322    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 299,270
Number of Sequences: 0
Number of extensions: 4478
Number of successful extensions: 49
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49
length of query: 1480
length of database: 62,899
effective HSP length: 77
effective length of query: 1403
effective length of database: 62,822
effective search space: 88139266
effective search space used: 88139266
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

END