Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_000866.1
Subject Sequence ID: ENSG00000140443
Subject Sequence type: 3

Query= gi|4557665|ref|NP_000866.1| insulin-like growth factor 1
receptor precursor [Homo sapiens]
         (1367 letters)

>ENSG00000140443
          Length = 308733

 Score =  382 bits (981), Expect = e-107
 Identities = 181/182 (99%), Positives = 182/182 (100%)
 Frame = +1

Query: 32    ICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVA 91
             +CGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVA
Sbjct: 58012 VCGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVA 58191

Query: 92    GLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCY 151
             GLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCY
Sbjct: 58192 GLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCY 58371

Query: 152   LSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRC 211
             LSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRC
Sbjct: 58372 LSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRC 58551

Query: 212   QK 213
             QK
Sbjct: 58552 QK 58557



 Score =  239 bits (610), Expect = 1e-64
 Identities = 103/104 (99%), Positives = 104/104 (100%)
 Frame = +2

Query: 214    MCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEG 273
              +CPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEG
Sbjct: 241775 VCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEG 241954

Query: 274    WRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ 317
              WRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ
Sbjct: 241955 WRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ 242086



 Score =  183 bits (465), Expect = 7e-48
 Identities = 93/134 (69%), Positives = 93/134 (69%)
 Frame = +1

Query: 1234   PDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSXXXXXXXXXXX 1293
              P  C    FELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYS           
Sbjct: 307489 PPVCLGCRFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEEL 307668

Query: 1294   XXXXXXXXXXXXXXXXXXXXXXXXDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGR 1353
                                      DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGR
Sbjct: 307669 DLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGR 307848

Query: 1354   KNERALPLPQSSTC 1367
              KNERALPLPQSSTC
Sbjct: 307849 KNERALPLPQSSTC 307890



 Score =  168 bits (426), Expect = 2e-43
 Identities = 79/79 (100%), Positives = 79/79 (100%)
 Frame = +3

Query: 531    PFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVE 590
              PFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVE
Sbjct: 263496 PFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVE 263675

Query: 591    NDHIRGAKSEILYIRTNAS 609
              NDHIRGAKSEILYIRTNAS
Sbjct: 263676 NDHIRGAKSEILYIRTNAS 263732



 Score =  166 bits (419), Expect = 2e-42
 Identities = 80/95 (84%), Positives = 80/95 (84%)
 Frame = +2

Query: 734    RPERKRRDVMQVXXXXXXXXXXXXXXXDTYNITDPEELETEYPFFESRVDNKERTVISNL 793
              RPERKRRDVMQV               DTYNITDPEELETEYPFFESRVDNKERTVISNL
Sbjct: 272597 RPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNL 272776

Query: 794    RPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA 828
              RPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA
Sbjct: 272777 RPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA 272881



 Score =  160 bits (406), Expect = 5e-41
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +1

Query: 983    AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMR 1042
              ++ VYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMR
Sbjct: 285265 SSPVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMR 285444

Query: 1043   ERIEFLNEASVMKEFNCHHVVR 1064
              ERIEFLNEASVMKEFNCHHVVR
Sbjct: 285445 ERIEFLNEASVMKEFNCHHVVR 285510



 Score =  158 bits (400), Expect = 2e-40
 Identities = 73/73 (100%), Positives = 73/73 (100%)
 Frame = +3

Query: 417    NYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGD 476
              NYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGD
Sbjct: 259137 NYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGD 259316

Query: 477    INTRNNGERASCE 489
              INTRNNGERASCE
Sbjct: 259317 INTRNNGERASCE 259355



 Score =  125 bits (313), Expect = 3e-30
 Identities = 58/67 (86%), Positives = 60/67 (89%)
 Frame = +2

Query: 610    VPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIP 669
              VPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSK K  
Sbjct: 266414 VPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKGKGA 266593

Query: 670    IRKYADG 676
                 + +G
Sbjct: 266594 AAAWTEG 266614



 Score =  119 bits (299), Expect = 1e-28
 Identities = 55/70 (78%), Positives = 56/70 (80%)
 Frame = +2

Query: 665    KDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPXXXXXXXXXXXXXXYRKVFEN 724
              +DKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACP              YRKVFEN
Sbjct: 267119 EDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFEN 267298

Query: 725    FLHNSIFVPR 734
              FLHNSIFVPR
Sbjct: 267299 FLHNSIFVPR 267328



 Score =  115 bits (289), Expect = 2e-27
 Identities = 58/72 (80%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +2

Query: 858    PNGLILMYEIK-YGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSW 916
              P  L+  +EI  Y    +DQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSW
Sbjct: 274922 PRFLLHSWEIDMYVLFPQDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSW 275101

Query: 917    TDPVFFYVQAKT 928
              TDPVFFYVQAK+
Sbjct: 275102 TDPVFFYVQAKS 275137



 Score =  110 bits (276), Expect = 6e-26
 Identities = 53/63 (84%), Positives = 57/63 (90%)
 Frame = +2

Query: 1099   ENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTR 1158
              +NNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG   +  
Sbjct: 289649 QNNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGGVSLAF 289828

Query: 1159   DIY 1161
               ++
Sbjct: 289829 QVW 289837



 Score =  105 bits (261), Expect = 3e-24
 Identities = 50/57 (87%), Positives = 50/57 (87%)
 Frame = +3

Query: 818    SNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVE 874
              SNFV       EGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVE
Sbjct: 274296 SNFVTCLNC-TEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVE 274463



 Score =  102 bits (255), Expect = 2e-23
 Identities = 54/71 (76%), Positives = 56/71 (78%)
 Frame = +3

Query: 1153   DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP 1212
              DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVW     L+ IA+L E P
Sbjct: 293373 DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWYEN--LYCIASL-EPP 293543

Query: 1213   YQGLSNEQVLR 1223
                 LS   V R
Sbjct: 293544 ASALSTSSVSR 293576



 Score = 99.0 bits (245), Expect = 2e-22
 Identities = 47/53 (88%), Positives = 49/53 (92%)
 Frame = +1

Query: 1192   YSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFEL 1244
              +S   SFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDML+ L
Sbjct: 299011 FSPCRSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLYVL 299169



 Score = 92.0 bits (227), Expect = 3e-20
 Identities = 42/42 (100%), Positives = 42/42 (100%)
 Frame = +3

Query: 489    ESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEA 530
              ESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEA
Sbjct: 261768 ESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEA 261893



 Score = 90.9 bits (224), Expect = 6e-20
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +3

Query: 371    ASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEG 416
              ASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEG
Sbjct: 249936 ASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEG 250073



 Score = 90.1 bits (222), Expect = 1e-19
 Identities = 40/40 (100%), Positives = 40/40 (100%)
 Frame = +3

Query: 318    SMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFK 357
              SMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFK
Sbjct: 247206 SMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFK 247325



 Score = 73.9 bits (180), Expect = 8e-15
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = +2

Query: 1063   VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME 1099
              VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME
Sbjct: 285767 VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME 285877



 Score = 67.4 bits (163), Expect = 8e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +3

Query: 1  MKSGSGGGSPTSLWGLLFLSAALSLWPTSGE 31
          MKSGSGGGSPTSLWGLLFLSAALSLWPTSGE
Sbjct: 33 MKSGSGGGSPTSLWGLLFLSAALSLWPTSGE 125



 Score = 53.5 bits (127), Expect = 1e-08
 Identities = 30/47 (63%), Positives = 31/47 (65%)
 Frame = +1

Query: 962    RNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQG 1008
              RNNSRLGNGVLYASVNPEYFSAAD   P      R    + REL  G
Sbjct: 280684 RNNSRLGNGVLYASVNPEYFSAADGKSPGHQHCQRAG-QVDRELSGG 280821



 Score = 29.3 bits (64), Expect = 0.23
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 10/124 (8%)
 Frame = +1

Query: 381   IEVVTGYVKIRHSHALVSLSFL-KNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNL 439
             + V+T Y+ +     L SL  L  NL +I G + L  NY+  + +  NL+ +  ++ RN+
Sbjct: 58150 LTVITEYLLLFRVAGLESLGDLFPNLTVIRGWK-LFYNYALVIFEMTNLKDIGLYNLRNI 58326

Query: 440   TIKAGKMYFAFNPKLC---------VSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES 490
             T   G +    N  LC         + +      + G K  +  GD+      E+  CE 
Sbjct: 58327 T--RGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEK 58500

Query: 491   DVLH 494
               ++
Sbjct: 58501 TTIN 58512



 Score = 26.9 bits (58), Expect = 1.1
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +2

Query: 834    IPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVED 875
              IP  V       + + +KW  P  PNG +  Y +++  Q +D
Sbjct: 266423 IPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQD 266548



 Score = 26.6 bits (57), Expect = 1.5
 Identities = 19/86 (22%), Positives = 31/86 (36%)
 Frame = +3

Query: 570    GLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIV 629
              GL PW   + +V  +  T   +D                    IP  V       + + +
Sbjct: 274272 GLPPWEPKSNFVTCLNCTEGADD--------------------IPGPVTWEPRPENSIFL 274391

Query: 630    KWNPPSLPNGNLSYYIVRWQRQPQDG 655
              KW  P  PNG +  Y +++  Q + G
Sbjct: 274392 KWPEPENPNGLILMYEIKYGSQVEVG 274469



 Score = 26.6 bits (57), Expect = 1.5
 Identities = 13/57 (22%), Positives = 22/57 (38%)
 Frame = +1

Query: 234    ECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAES 290
              +C+ +C        C   R +  A  C  A    +   EGW C  R+    ++  E+
Sbjct: 232975 DCISACCL*TGPGGCHGPRSFLPAFACHKAVLQPSVTSEGWECRRRE*IGTVMRGEN 233145



 Score = 25.4 bits (54), Expect = 3.3
 Identities = 12/24 (50%), Positives = 12/24 (50%)
 Frame = +1

Query: 230   CCHPECLGSCSAPDNDTACVACRH 253
             CC P C    S P N  ACV C H
Sbjct: 89761 CCCPVCH---SLPSNS*ACVLCFH 89823



 Score = 24.3 bits (51), Expect = 7.4
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 209    NRCQKMCPSTCGK 221
              NRC  MC  TCG+
Sbjct: 121881 NRCADMCAYTCGR 121919



 Score = 23.9 bits (50), Expect = 9.6
 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 10/34 (29%)
 Frame = -3

Query: 178    CGDLCPGTME----------EKPMCEKTTINNEY 201
              C  LCPGT +          E P+ EK ++N  Y
Sbjct: 224170 CNSLCPGTCKTYRKSSTTYIENPLPEK*SVNTLY 224069



 Score = 23.9 bits (50), Expect = 9.6
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +2

Query: 314   NGSQSMYCIPCEGPCPKVCEEEKKTKT 340
             NG+  ++  P  GP P   EE KK KT
Sbjct: 10889 NGTLVIFEFPGGGPVPGA*EELKKRKT 10969



 Score = 23.9 bits (50), Expect = 9.6
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -1

Query: 232    HPECLGSCSAPDNDTACVACRHYY 255
              HPE LG C    +     +CR YY
Sbjct: 302202 HPETLGQCYGEAHVEQGDSCRAYY 302131


Lambda     K      H
   0.319    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 577,503
Number of Sequences: 0
Number of extensions: 10564
Number of successful extensions: 64
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of query: 1367
length of database: 102,911
effective HSP length: 80
effective length of query: 1287
effective length of database: 102,831
effective search space: 132343497
effective search space used: 132343497
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

END