Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009229.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552307|ref|NP_009229.1| breast cancer 1, early onset
isoform BRCA1-delta9-11; breast-ovarian cancer, included [Homo
sapiens]
         (680 letters)

>ENSG00000012048
          Length = 81091

 Score =  167 bits (422), Expect = 9e-44
 Identities = 89/107 (83%), Positives = 90/107 (84%)
 Frame = -3

Query: 376   EGTPYLESGISLFXXXXXXXXXXXXXXXXARVGNIPSSTSALKVPQLKVAESAQSPAAAH 435
             EGTPYLESGISLF                ARVGNIPSSTSALKVPQLKVAESAQSPAAAH
Sbjct: 26939 EGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAH 26760

Query: 436   TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLV 482
             TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEF+ V
Sbjct: 26759 TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFVSV 26619



 Score =  137 bits (345), Expect = 7e-35
 Identities = 64/66 (96%), Positives = 65/66 (98%)
 Frame = -1

Query: 310   VERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 369
             + RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
Sbjct: 30229 LSRSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 30050

Query: 370   LPRQDL 375
             LPRQDL
Sbjct: 30049 LPRQDL 30032



 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = -1

Query: 102   ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 147
             ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL
Sbjct: 59959 ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 59822



 Score = 90.9 bits (224), Expect = 8e-21
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = -2

Query: 640  AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 680
            AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
Sbjct: 1503 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1381



 Score = 88.2 bits (217), Expect = 5e-20
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = -3

Query: 269   KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 312
             KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER
Sbjct: 32318 KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 32187



 Score = 87.4 bits (215), Expect = 9e-20
 Identities = 45/60 (75%), Positives = 46/60 (76%)
 Frame = -1

Query: 212   QQRDTMQHNLIKLQQEMAELEAVLEQHGSQXXXXXXXXXXXXXALEDLRNPEQSTSEKAV 271
             +QRDTMQHNLIKLQQEMAELEAVLEQHGSQ             ALEDLRNPEQSTSEK V
Sbjct: 38278 KQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKGV 38099



 Score = 71.6 bits (174), Expect = 5e-15
 Identities = 36/37 (97%), Positives = 37/37 (100%)
 Frame = -3

Query: 148   QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGE 184
             QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG+
Sbjct: 55580 QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGK 55470



 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 33/37 (89%), Positives = 35/37 (94%)
 Frame = -3

Query: 176   TSVYIELGEAASGCESETSVSEDCSGLSSQSDILTTQ 212
             TSV++  GEAASGCESETSVSEDCSGLSSQSDILTTQ
Sbjct: 46754 TSVFVI*GEAASGCESETSVSEDCSGLSSQSDILTTQ 46644



 Score = 65.1 bits (157), Expect = 5e-13
 Identities = 28/30 (93%), Positives = 30/30 (100%)
 Frame = -1

Query: 548   EHDFEVRGDVVNGRNHQGPKRARESQDRKI 577
             +HDFEVRGDVVNGRNHQGPKRARESQDRK+
Sbjct: 12838 QHDFEVRGDVVNGRNHQGPKRARESQDRKV 12749



 Score = 62.0 bits (149), Expect = 4e-12
 Identities = 27/30 (90%), Positives = 28/30 (93%)
 Frame = -2

Query: 42    IFCKFCMLKLLNQKKGPSQCPLCKNDITKR 71
             I  +FCMLKLLNQKKGPSQCPLCKNDITKR
Sbjct: 62244 IIYRFCMLKLLNQKKGPSQCPLCKNDITKR 62155



 Score = 60.5 bits (145), Expect = 1e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -1

Query: 71    RSLQESTRFSQLVEELLKIICAFQLDTGLE 100
             RSLQESTRFSQLVEELLKIICAFQLDTGLE
Sbjct: 60658 RSLQESTRFSQLVEELLKIICAFQLDTGLE 60569



 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 27/31 (87%), Positives = 27/31 (87%)
 Frame = -3

Query: 504   VVMKTDAEFVCERTLKYFLGIAGGKWVVSYF 534
             V    DAEFVCERTLKYFLGIAGGKWVVSYF
Sbjct: 19667 VFHSADAEFVCERTLKYFLGIAGGKWVVSYF 19575



 Score = 53.9 bits (128), Expect = 1e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = -3

Query: 595  DQLEWMVQLCGASVVKELSSFTLGT 619
            DQLEWMVQLCGASVVKELSSFTLGT
Sbjct: 4895 DQLEWMVQLCGASVVKELSSFTLGT 4821



 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -3

Query: 1     MDLSALRVEEVQNVINAMQKILECPI 26
             MDLSALRVEEVQNVINAMQKILECPI
Sbjct: 79796 MDLSALRVEEVQNVINAMQKILECPI 79719



 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = -1

Query: 620  GVHPIVVVQPDAWTEDNGFHAIGQMCEAPV 649
            GVHPIVVVQPDAWTEDNGFH     C   +
Sbjct: 3403 GVHPIVVVQPDAWTEDNGFHGKVPACTCAI 3314



 Score = 45.8 bits (107), Expect = 3e-07
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = -1

Query: 576  KIFRGLEICCYGPFTNMPT 594
            +IFRGLEICCYGPFTNMPT
Sbjct: 6820 QIFRGLEICCYGPFTNMPT 6764



 Score = 44.7 bits (104), Expect = 7e-07
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = -2

Query: 25    PICLELIKEPVSTKCDHIFCK 45
             P  LELIKEPVSTKCDHIFCK
Sbjct: 71487 PASLELIKEPVSTKCDHIFCK 71425



 Score = 30.4 bits (67), Expect = 0.013
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = -1

Query: 480   MLVYKFARKHXXXXXXXXXXXXXXVVMKT 508
             MLVYKFARKH              VVMKT
Sbjct: 23395 MLVYKFARKHHITLTNLITEETTHVVMKT 23309



 Score = 28.5 bits (62), Expect = 0.049
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -2

Query: 536   VTQSIKERKMLNE 548
             VTQSIKERKMLNE
Sbjct: 19071 VTQSIKERKMLNE 19033



 Score = 22.7 bits (47), Expect = 2.7
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)
 Frame = -2

Query: 182   LGEAASGCESETSVSEDC--SGLSSQ 205
             LG  A  C S T   EDC  SG+  Q
Sbjct: 58644 LGAVAHACNSSTRRLEDCLSSGVQDQ 58567



 Score = 21.2 bits (43), Expect = 7.8
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +3

Query: 512   FVCERTLKYFLGIA 525
             F+CE TL Y+L ++
Sbjct: 49728 FICEGTLLYYLWLS 49769


Lambda     K      H
   0.314    0.129    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,856
Number of Sequences: 0
Number of extensions: 811
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of query: 680
length of database: 27,030
effective HSP length: 66
effective length of query: 614
effective length of database: 26,964
effective search space: 16555896
effective search space used: 16555896
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 42 (20.8 bits)

END