Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: O35923
Subject Sequence ID: ENSG00000139618
Subject Sequence type: 3

Query= sp|O35923|BRCA2_RAT Breast cancer type 2 susceptibility protein
homolog - Rattus norvegicus (Rat).
         (3343 letters)

>ENSG00000139618
          Length = 84189

 Score = 1332 bits (3448), Expect = 0.0
 Identities = 825/1684 (48%), Positives = 1107/1684 (65%), Gaps = 58/1684 (3%)
 Frame = +1

Query: 620   GIPDSSIKRSNLPNDPEEPSLSLTNSFVTAASK----EISYIHALISQDLNDKEAILSEE 675
             G+  SS+KRS   ND EEP+LSLT+SF T   K    E    + +ISQDL+ KEA  ++E
Sbjct: 20785 GLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKE 20964

Query: 676   KPQPYTALEADFLSCLPERSCENDQKSPKVSDRKEKVLVSACRPSGRLAAAVQLSSISFD 735
             K Q +   EAD LSCL E  CEND KS KVSD KE+VL +AC P     + V+ S   F 
Sbjct: 20965 KLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQH--SKVEYSDTDFQ 21138

Query: 736   SQENPLGSHNVTSTLKLTPSPKTPLSKPVVVSRGKMC-KMPEKLQCKSCKDNIELSKNIP 794
             SQ++ L  H   STL LTP+ K  LS  V++SRGK   KM +KL+  + + ++EL+KNIP
Sbjct: 21139 SQKSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIP 21318

Query: 795   LGVNE-MCVLSENSETPELLPPLEYITEVSSSVKSQFNQNTKIAVVQKDQKDSTFISEVT 853
             +  N+ +C L+EN +  ELLPP +Y+   S S K QFNQNT + V+QK+Q+++T IS++T
Sbjct: 21319 MEKNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKIT 21498

Query: 854   VHMNSEELFPEKENNFAFQVTNESNKPNIGSTVEFQEEDLSHAKGHSLKNSPMTVDRDLD 913
             V+ +SEELF + ENNF FQV NE N   +G+T E  E DL+       KNS M +  D  
Sbjct: 21499 VNPDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTG 21678

Query: 914   DEQAGQVLITEDSDSLAVVHDCTKKSRNTIEQHQKGTADKDFKSNSSLYLKS--DGNNDY 971
             D+QA QV I +D     +V+   ++++N+++QH K T  +D KS+ SL +    + NNDY
Sbjct: 21679 DKQATQVSIKKD-----LVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDY 21843

Query: 972   LDKWSEFLDPLMNHKLGGSFRTASNKEIKLSEDNVKKSKMFFKDIEEQYPTSLDCIDTVS 1031
             ++KW+  L P+ NH  GGSFRTASNKEIKLSE N+KKSKMFFKDIEEQYPTSL C++ V+
Sbjct: 21844 MNKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVN 22023

Query: 1032  TLQLANKKRLSEPHTFDLKSGTTVSTQCHSQSSVSHED---THTAPQMLSSKQDFHSSHN 1088
             TL L N+K+LS+P + +     TVS   H QSSV   D   +H  PQML SKQDF+S+HN
Sbjct: 22024 TLALDNQKKLSKPQSIN-----TVSA--HLQSSVVVSDCKNSHITPQMLFSKQDFNSNHN 22182

Query: 1089  LTPSQKAEITELSTILEESGSQFEFTQFKNPSHIAQNNTSAVLGNQMAVVRTASEEWKDV 1148
             LTPSQKAEITELSTILEESGSQFEFTQF+ PS+I Q +T  V  NQM +++T SEE +D 
Sbjct: 22183 LTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDA 22362

Query: 1149  DLHLPLNPSSVGQIDHNKKFECLVGVKQSSSHLLEDTCNQNTSCFLPIK-EMEFGGFCSA 1207
             DLH+ +N  S+GQ+D +K+FE  V +K+  + LL++ CN++ S +L  + E+ F GF SA
Sbjct: 22363 DLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSA 22542

Query: 1208  LGTKLSVSNEALRKAMKLFSDIENISEEPSTKVGPRGFSSCAHHDSVASVFKIKKQNTDK 1267
              GTKL+VS EAL+KA+KLFSDIENISEE S +V P   SS   HDSV S+FKI+  N DK
Sbjct: 22543 HGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHN-DK 22719

Query: 1268  SFDEKSSKCQVTVQNNKEMTTCILVDENPENYVKNIK-QDNNYTGSQRNAYKLENSDVSK 1326
             +  EK++KCQ+ +QNN EMTT   V+E  ENY +N + +DN YT + RN++ LE  D S 
Sbjct: 22720 TVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLE-FDGSD 22896

Query: 1327  SSTSGTVYINKGDSDLPFAAEKGNKYPESCTQYVREENAQIKESVSDLTCLEVMKAEETC 1386
             SS + TV I+K ++DL F  ++ N   +   Q+++E N QIKE +SDLT LEV KA+E C
Sbjct: 22897 SSKNDTVCIHKDETDLLF-TDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEAC 23073

Query: 1387  HMKSSDKEQLPSDKMEQNMKEFNIS---FQTASGKNIRVSKESLNKSVNILDQETEDLTV 1443
             H  +S+KEQL + K EQN+K+F  S   FQTASGKNI V+KES NK VN  DQ+ E+L  
Sbjct: 23074 HGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEEL-- 23247

Query: 1444  TSDSLNSKILCGINKDKMHISCHKKSINIK-KVFEEHFPIGTVSQLPALQQYPEYEIESI 1502
              + SLNS++   I K+KM I  ++++  +K K+ +E  P+GT +QL   Q  PE + E I
Sbjct: 23248 HNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERD-EKI 23424

Query: 1503  KEPTLLSFHTASGKKVKIMQESLDKVKNLFDE-TQYVRKTTNFGHQESKPLKDREDYKER 1561
             KEPTLL FHTASGKKVKI +ESLDKVKNLFDE  Q   + T+F HQ +K LK RE  K+ 
Sbjct: 23425 KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKD- 23601

Query: 1562  LTLAYEKIEVTAS-KCEEMQ-------NFVSKQTEMLPQ-QNDHMYRQTENLTSNGS--- 1609
             L LA E IE+TA+ KC+EMQ       N VS +T + P+  +D++ RQTENL ++ S   
Sbjct: 23602 LELACETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFL 23781

Query: 1610  SPKVHGNIENKIEKNPRICCICQSSYFVTEDSALACYTGDSRKTCVGESSLSKGKKWLRE 1669
               KVH N+E +  K+P  C   QS Y V E+SALA YT  SRKT V ++SL + KKWLRE
Sbjct: 23782 KVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLRE 23961

Query: 1670  QSDKLGTRNTIEIQCVKEHTEDFAGNALYEHSLVIIRTEIDTSHVSENQASTLFSDPNVC 1729
                        + Q  + +T D+ GN LYE++      E D +H+SE Q      D  + 
Sbjct: 23962 --------GIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQ------DTYLS 24099

Query: 1730  HSYLSHSSFCHHDDMHNDSGYFLKDKIDSDVQPDMKNTEG--NAIFPK-ISATKEIKLHP 1786
             +S +S+S   H D+++NDSGY  K+K+DS ++P +KN E   N  F K IS  K+   +P
Sbjct: 24100 NSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYP 24279

Query: 1787  QTVNEE-CVQKLETNASPYANKNIAIDSAMLDLRNCKVGSPVF------ITTHSQETV-R 1838
             QTVNE+ CV++L T++SP  NKN AI  ++ +  N +VG P F      I   S ET+ +
Sbjct: 24280 QTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKK 24459

Query: 1839  MKEIFTDNCSKIVEQNRESKPDTCQT----SCHKALDNSEDFICPSSSGDVCINSPMAIF 1894
             +K+IFTD+ SK++++N E+K   CQT     C++ALD+SED +  S   D C      +F
Sbjct: 24460 VKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKVF 24639

Query: 1895  YP-QSEQILQHNQSVSGLKKAA--TP-PVSLETWDTCK-SIRGSPQEVHPSRTYGFFSTA 1949
                QSE+ILQHNQ++SGL+K +  +P  VSLET D CK SI    + V  + T G FSTA
Sbjct: 24640 ADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSANTCGIFSTA 24819

Query: 1950  SGKAVQVSDASLEKARQVFSEIDGDAKQLASMVSLEGNEKSHHSVKRESSVVHNTHGVLS 2009
             SGK+VQVSDASL+ ARQVFSEI+   KQ+ S V  + NE S    + E++ +     ++S
Sbjct: 24820 SGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLIS 24999

Query: 2010  LRKTLPGNXXXXXXXXXXTAGGKLVTVSESALHKVKGMLEEFDLIRTEHTLQHSPTP-ED 2068
              +                TA GK V++ ES+LHKVKG+LEEFDLIRTEH+L +SPT  ++
Sbjct: 25000 QKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQN 25179

Query: 2069  VSKIPPQPCLESRTPEYSVSSKLQKTYNDKSRSPSNYK-ESGSSGNTQSLEVSPQLSQME 2127
             VSKI P+  ++ R PE+ V+S+++KT + + +  +N   E GSS N  S++VSP LSQ +
Sbjct: 25180 VSKILPR--VDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQ 25353

Query: 2128  RKQETQSVLGTKVS-QRKTNILEKKQNLPQNIKIESNKMETFSDVSMKTN--VGEYYSKE 2184
             + ++ Q VLGTKVS     ++L K+Q  P+N+K+E  K ETFSDV +KTN  V   YSK+
Sbjct: 25354 QDKQ-QLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKD 25530

Query: 2185  PENYFETEAVEIAKAFMEDDELTDSE-QTHAKCSLFACPQNE--ALLNSRTRKRGGMAGV 2241
              ENYFETEAVEIAKAFMEDDELTDS+  +HA  SLF CP+NE   L NSR  KR G   +
Sbjct: 25531 SENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLI 25710

Query: 2242  AVGQ 2245
              VG+
Sbjct: 25711 LVGK 25722



 Score =  337 bits (864), Expect = 3e-94
 Identities = 189/367 (51%), Positives = 235/367 (64%), Gaps = 9/367 (2%)
 Frame = +1

Query: 263   SSSKINRFRDCLRKPIPNVLEDG--ETAVDTSGEDSFSLCFPKRRTRNLQKTRMGKMKKK 320
             +S K+N  +D + K +PNVLED   ET VDTS EDSFSLCF K RT+NLQK R  K +KK
Sbjct: 16813 NSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKK 16992

Query: 321   IFSETRTDGLSEEARGQADDKNSFALEIEPRDSEPLDPSVTNQKPLYSQSGDISSEAGQC 380
             IF E   D   E+++ Q  +K SF  E+EP D++PLD +V NQKP  S S  IS E    
Sbjct: 16993 IFHEANADEC-EKSKNQVKEKYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPS 17169

Query: 381   SDSIWSQPDPSGLNGTQTRKIPLLHISFHKQSILE-DFIDMKKEG-----TGSITFPHIS 434
                 WSQ   SGLNG Q  KIPLLHIS   Q+I E D +D + +      T   + P IS
Sbjct: 17170 LACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSENSLPRIS 17349

Query: 435   SLPEPEKMFSEETLVDKEHEGQHLESLEDSISG-KQMVSGTSQTACLSPSIRKSIVKMRE 493
             SLP+ EK  +EET+V+K  E QHLES  D I   KQ +SGTS  A     I+KSI ++RE
Sbjct: 17350 SLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIKKSIFRIRE 17529

Query: 494   PLEETLDTVFSDSMTSSAFTEELDASAGGLEIHTACSQREDSLCPSSVDTGSWPTTLTDT 553
               +ET +  FS  MT   F +E +AS  GLEIHT CSQ+EDSLCP+ +D GSWP T T  
Sbjct: 17530 SPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGSWPATTTQN 17709

Query: 554   SATVKNAGLITTLKNKRRKFIYSVSDDASHQGKKLQTQRQSELTNLSAPFEASAFEVPFP 613
             S  +KNAGLI+TLK K  KFIY++ D+ S++GKK+   ++SEL N SA FEA+AFE P  
Sbjct: 17710 SVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANAFEAPLT 17889

Query: 614   FTNVDSG 620
             F N DSG
Sbjct: 17890 FANADSG 17910



 Score =  197 bits (502), Expect = 3e-52
 Identities = 99/140 (70%), Positives = 116/140 (82%)
 Frame = +1

Query: 2570  KEFANRCLNPERVLLQLKYRYDVEIDNSSRSALKKILERDDTAAKTLVLCVSDIISLSTN 2629
             K++ +R   P+  +    +RYD EID S RSA+KKI+ERDDTAAKTLVLCVSDIISLS N
Sbjct: 47641 KQWNSRVTLPKICIFVFTFRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSAN 47820

Query: 2630  VSETSGSKASSEDSNKVDTIELTDGWYAVKAQLDPPLLALVKSGRLTVGQKIITQGAELV 2689
             +SETS +K SS D+ KV  IELTDGWYAVKAQLDPPLLA++K+GRLTVGQKII  GAELV
Sbjct: 47821 ISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELV 48000

Query: 2690  GSPDACAPLEAPDSLRLKIS 2709
             GSPDAC PLEAP+SL LK++
Sbjct: 48001 GSPDACTPLEAPESLMLKVN 48060



 Score =  156 bits (395), Expect = 7e-40
 Identities = 85/177 (48%), Positives = 111/177 (62%)
 Frame = +3

Query: 3149  SSPTDQQSYRSPLSCCTPTGKSTPLAHSAWMAAKSCSGENEIEDPKTCRKKRALDXXXXX 3208
             SSP  +  Y+SPLS C    KS     SA M +KSC GE EI+D K C+K+RALD     
Sbjct: 82686 SSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRL 82865

Query: 3209  XXXXXXXXVCTFVSPAAQKAFQPPRSCGTKYPTPLKKEGPSSPWSRAPFQKASGVSLLDC 3268
                     +CTFVSPAAQKAFQPPRSCGTKY TP+KK+  +SP    PF+K + +SLL+ 
Sbjct: 82866 PLPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSP-QMTPFKKFNEISLLES 83042

Query: 3269  DSVADEELALLSTQALVPHSVGGSEQVFPSDSTRTEGPSASTEARPANRSKRESLRD 3325
             +S+ADEELAL++TQAL+  S G  + +  S+STRT   S+    R   R     +++
Sbjct: 83043 NSIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKE 83213



 Score =  120 bits (302), Expect = 4e-29
 Identities = 58/76 (76%), Positives = 63/76 (82%)
 Frame = +3

Query: 23   DLGPISLNWFEELFSEAPPYNTEHPEESEYKPQGHEPQLFKTPQRNPSYHQFASTPIMFK 82
            DLGPISLNWFEEL SEAPPYN+E  EESE+K   +EP LFKTPQR PSY+Q ASTPI+FK
Sbjct: 3597 DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFK 3776

Query: 83   EQSQTLPLDQSPFKEL 98
            EQ  TLPL QSP KEL
Sbjct: 3777 EQGLTLPLYQSPVKEL 3824



 Score =  120 bits (300), Expect = 7e-29
 Identities = 60/83 (72%), Positives = 68/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query: 3013  IGLAPLVYLSDECLHLLVVKFGIDLNEDI-KPRVLIAASNLQWRPESTSRVPTLFAGNFS 3071
             +GLAP VYLSDEC +LL +KF IDLNEDI KP +LIAASNLQWRPES S + TLFAG+FS
Sbjct: 79206 LGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFS 79385

Query: 3072  VFSASPKEAHFQERVTNMKHAIE 3094
             VFSASPKE HFQE    MK+ +E
Sbjct: 79386 VFSASPKEGHFQETFNKMKNTVE 79454



 Score =  118 bits (295), Expect = 3e-28
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +2

Query: 2531  YRALCDTPGVDPKLISSVWVSNHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYR 2589
             +RALCDTPGVDPKLIS +WV NHYRWI+WKLAAME AFPKEFANRCL+PERVLLQLKYR
Sbjct: 47039 FRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR 47215



 Score =  113 bits (283), Expect = 6e-27
 Identities = 64/120 (53%), Positives = 73/120 (60%), Gaps = 31/120 (25%)
 Frame = +1

Query: 2911  KSALLSIWRPSSDLPSLLTEGQRYRIYHLSVSKSKNKFEWPSIQLTATKRTQYQQLP--- 2967
             ++ +LSIWRPSSDL SLLTEG+RYRIYHL+ SKSK+K E  +IQL ATK+TQYQQLP   
Sbjct: 64264 QTVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVQT 64443

Query: 2968  ----------------------------VSSETLLQLYQPRELLPFSKLSDPAFQPPCSE 2999
                                         VS E L Q+YQPRE L FSK  DP FQP CSE
Sbjct: 64444 FHCNFSVLISAC*FMESPYVEFLFCFL*VSDEILFQIYQPREPLHFSKFLDPDFQPSCSE 64623



 Score =  106 bits (265), Expect = 8e-25
 Identities = 49/63 (77%), Positives = 54/63 (85%)
 Frame = +2

Query: 2470  LYMYGVSKACISVNSKNAEYFQFAIEDHFGKEALCAGKGFRLADGGWLIPSDDGKAGKEE 2529
             LY YGVSK CI +NSKNAE FQF  ED+FGKE+L  GKG +LADGGWLIPS+DGKAGKEE
Sbjct: 42263 LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE 42442

Query: 2530  FYR 2532
             FYR
Sbjct: 42443 FYR 42451



 Score = 93.6 bits (231), Expect = 7e-21
 Identities = 45/62 (72%), Positives = 54/62 (87%)
 Frame = +1

Query: 2409  DLMSSLQNARDLQDIRIKNKERHHLCPQPGSLYLTKSSTLPRISLQAAVGDSVPSACSPK 2468
             DL++SLQNARD+QD+RIK K+R  + PQPGSLYL K+STLPRISL+AAVG  VPSACS K
Sbjct: 40948 DLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHK 41127

Query: 2469  QL 2470
             Q+
Sbjct: 41128 QV 41133



 Score = 90.1 bits (222), Expect = 8e-20
 Identities = 59/129 (45%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2297  PFCSS-KERQETQSPHVTSPAQGLQSKEHPSRHSAVGKSSSNPT--------VSALRSER 2347
             P CS+ KERQE Q+P+ T+P Q   SK H   H  + KSSSN          VSA R+E+
Sbjct: 39371 PHCSTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEK 39550

Query: 2348  TRHSV-SDKSTKVFVPPFKVKSRFHRDEHFDSKNVNLEGKNQK-SADGVSEDG-----ND 2400
              RH + + + TKVFVPPFK KS FHR E    +N+NLE   QK + DG   D      ND
Sbjct: 39551 MRHLITTGRPTKVFVPPFKTKSHFHRVEQC-VRNINLEENRQKQNIDGHGSDDSKNKIND 39727

Query: 2401  SDFPQFNKD 2409
             ++  QFNK+
Sbjct: 39728 NEIHQFNKN 39754



 Score = 81.6 bits (200), Expect = 3e-17
 Identities = 38/54 (70%), Positives = 45/54 (83%)
 Frame = +1

Query: 2758  LQWVEKTVSGSYIFRNEREEEKEALRFAEAQQKKLEALFTKVHTELKEHEEDIA 2811
             LQW+EKT SG YIFRNEREEEKEA ++ EAQQK+LEALFTK+  E +EHE  I+
Sbjct: 55471 LQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHEGKIS 55632



 Score = 80.1 bits (196), Expect = 8e-17
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 1/64 (1%)
 Frame = +1

Query: 2851  FSEEQLRALNNYRQMLSDKKQARIQSEFR-XXXXXXXXXXGLSRDVSTVWKLRVTSYKKR 2909
             FSEEQLRALNN+RQML+DKKQA+IQ E R           GLSRDV+TVWKLR+ SY K+
Sbjct: 63844 FSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKK 64023

Query: 2910  EKSA 2913
             EK +
Sbjct: 64024 EKDS 64035



 Score = 78.2 bits (191), Expect = 3e-16
 Identities = 35/54 (64%), Positives = 41/54 (75%)
 Frame = +2

Query: 2706  LKISANSTRPARWHSKLGFFHDPRXXXXXXXXXXXDGGNVGCVDVIVQRVYPLQ 2759
             ++ISANSTRPARW++KLGFF DPR           DGGNVGCVDVI+QR YP+Q
Sbjct: 54917 VQISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPIQ 55078



 Score = 60.5 bits (145), Expect = 6e-11
 Identities = 28/38 (73%), Positives = 34/38 (89%)
 Frame = +2

Query: 218   SLKSYFSNHNESLKKNDRFIPSVSDSENKSQQEAFSQG 255
             ++KSYFSNH+ESLKKNDRFI SV+DSEN +Q+EA S G
Sbjct: 15440 NVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHG 15553



 Score = 54.7 bits (130), Expect = 4e-09
 Identities = 26/36 (72%), Positives = 31/36 (86%)
 Frame = +2

Query: 2243  VGQPPIKRSLLNEFDRIIESKGKSLTPSKSTPDGTI 2278
             +G+P IKR+LLNEFDRIIE++ KSL  SKSTPDG I
Sbjct: 29075 LGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGKI 29182



 Score = 52.0 bits (123), Expect = 2e-08
 Identities = 25/32 (78%), Positives = 29/32 (90%)
 Frame = +2

Query: 2817  SRALTRQQVHALQDGAELYAAVQDASDPEHLE 2848
             SRALTRQQV ALQDGAELY AV++A+DP +LE
Sbjct: 61217 SRALTRQQVRALQDGAELYEAVKNAADPAYLE 61312



 Score = 47.8 bits (112), Expect = 4e-07
 Identities = 22/48 (45%), Positives = 27/48 (56%)
 Frame = +1

Query: 158   FYTPKLEETPKHISESLGVEVDPDMSWXXXXXXXXXXXXXVLIARDEE 205
             F + +  +TPKHISESLG EVDPDMSW             VLI  + +
Sbjct: 11005 FLSSQGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGNNSK 11148



 Score = 47.0 bits (110), Expect = 7e-07
 Identities = 21/38 (55%), Positives = 24/38 (63%)
 Frame = +2

Query: 3095  NIDTFYKEAEKKLIQVLKGDSPKWSTPNKDPTREPYPA 3132
             NID    EAE KL+ +L  + PKWSTP KD T  PY A
Sbjct: 81419 NIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTA 81532



 Score = 46.6 bits (109), Expect = 1e-06
 Identities = 19/23 (82%), Positives = 21/23 (91%)
 Frame = +3

Query: 2276  GTIKDRRLFTHHMSLEPVTCGPF 2298
             GTIKDRRLF HH+SLEP+TC PF
Sbjct: 31347 GTIKDRRLFMHHVSLEPITCVPF 31415



 Score = 32.0 bits (71), Expect = 0.024
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 1    MTVEYKRRPTFWEIFKARCSTADL 24
            M +  K RPTF+EIFK RC+ A +
Sbjct: 982  MPIGSKERPTFFEIFKTRCNKAGI 1053



 Score = 25.4 bits (54), Expect = 2.3
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +1

Query: 2833  ELYAAVQDASDPEHLETCFSEEQLRALNNYRQMLSDKK 2870
             E+Y  V D S+ +    CFS+ + + L   R   + KK
Sbjct: 16879 EVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKK 16992



 Score = 25.0 bits (53), Expect = 3.0
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 151   PVVSGSLFYTPK 162
             PVV GSLF+TPK
Sbjct: 10759 PVVCGSLFHTPK 10794



 Score = 24.3 bits (51), Expect = 5.1
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +3

Query: 135   SPCTPRCTQVAPQRRKP-VVSGSLFYT 160
             SP   +CT V PQR K  ++  + FY+
Sbjct: 10620 SPVVLQCTHVTPQRDKSGMIKNNAFYS 10700



 Score = 23.5 bits (49), Expect = 8.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -3

Query: 2961  TQYQQLPVSSETLLQLYQPRELLPFSKL 2988
             +QY  +P+ +  L  + QPR LL + KL
Sbjct: 21133 SQYHCIPLLNVVLGDMLQPRPLLLYLKL 21050


Lambda     K      H
   0.311    0.127    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 299,984
Number of Sequences: 0
Number of extensions: 4390
Number of successful extensions: 75
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34
length of query: 3343
length of database: 28,063
effective HSP length: 78
effective length of query: 3265
effective length of database: 27,985
effective search space: 91371025
effective search space used: 91371025
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)

END