Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P01343
Subject Sequence ID: ENSG00000017427
Subject Sequence type: 3

Query= sp|P01343|IGF1A_HUMAN Insulin-like growth factor IA precursor
(IGF-IA) (Somatomedin C) (Mechano growth factor) (MGF) - Homo sapiens
(Human).
         (153 letters)

>ENSG00000017427
          Length = 78292

 Score =  129 bits (325), Expect = 2e-33
 Identities = 63/73 (86%), Positives = 64/73 (87%)
 Frame = -1

Query: 62    LQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV 121
             L  +C D      KPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV
Sbjct: 17455 LCLICAD------KPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV 17294

Query: 122   RAQRHTDMPKTQK 134
             RAQRHTDMPKTQK
Sbjct: 17293 RAQRHTDMPKTQK 17255



 Score =  112 bits (281), Expect = 3e-28
 Identities = 53/55 (96%), Positives = 55/55 (100%)
 Frame = -2

Query: 21    KVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNK 75
             +VKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYF+K
Sbjct: 73548 QVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFSK 73384



 Score = 52.0 bits (123), Expect = 7e-10
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = -1

Query: 1     MGKISSLPTQLFKCCFCDFLKVKM 24
             MGKISSLPTQLFKCCFCDFLKV +
Sbjct: 78127 MGKISSLPTQLFKCCFCDFLKVNI 78056



 Score = 42.7 bits (99), Expect = 4e-07
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = -2

Query: 135 EVHLKNASRGSAGNKNYRM 153
           EVHLKNASRGSAGNKNYRM
Sbjct: 312 EVHLKNASRGSAGNKNYRM 256



 Score = 23.5 bits (49), Expect = 0.25
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +3

Query: 70    GFYFNKPTGYGSSS 83
             GFYF +PT +  SS
Sbjct: 11766 GFYFRRPTSFSHSS 11807



 Score = 21.9 bits (45), Expect = 0.73
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = -2

Query: 4     ISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTS 44
             IS  P  L    F DFL + + T    +L  + +C+   TS
Sbjct: 46677 ISISPHPLQHLLFPDFLMITILTGMRWYLIVVLICISLMTS 46555



 Score = 21.6 bits (44), Expect = 0.95
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
 Frame = -3

Query: 34   YLALCLLTFTS---SATAGPETLCGAELVDALQFVCGDRGFY 72
            Y  +CLLTF S   ++   P  L     +++L FV  +R  Y
Sbjct: 4373 YFLMCLLTFPSKG*TSLTNPSELEDQCFLNSLTFVGVNRKQY 4248



 Score = 20.4 bits (41), Expect = 2.1
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = +1

Query: 8     PTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTF 42
             P  +F    C F   K+ ++  SHL   A     F
Sbjct: 35140 PRLIFHSVNCSFAVQKLFSLM*SHLSIFAFVAFAF 35244



 Score = 20.4 bits (41), Expect = 2.1
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -3

Query: 4     ISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLT 41
             +  +PT      F +   + +HTM SS     + CLLT
Sbjct: 76955 VPEMPTHAGHLAFKEMTSLCIHTM*SSS---WSFCLLT 76851



 Score = 20.0 bits (40), Expect = 2.8
 Identities = 10/24 (41%), Positives = 11/24 (45%)
 Frame = -3

Query: 14    CCFCDFLKVKMHTMSSSHLFYLAL 37
             CC+C F         S  LFYL L
Sbjct: 62315 CCYCKF---------SFSLFYLEL 62271



 Score = 19.6 bits (39), Expect = 3.6
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 98    RSCDLRRLEMYCAPLKPAKSAR 119
             R+C +  L   C PL   +S+R
Sbjct: 11118 RNCRIYYLRKQCFPLVGGRSSR 11183



 Score = 18.9 bits (37), Expect = 6.1
 Identities = 9/25 (36%), Positives = 11/25 (44%)
 Frame = +1

Query: 31    HLFYLALCLLTFTSSATAGPETLCG 55
             H   L  CLL+    +  G   LCG
Sbjct: 27796 HFISLDTCLLSALFVSHLGLRKLCG 27870



 Score = 18.9 bits (37), Expect = 6.1
 Identities = 7/19 (36%), Positives = 9/19 (47%)
 Frame = +1

Query: 95    CCFRSCDLRRLEMYCAPLK 113
             CCF     R  +MY   +K
Sbjct: 14674 CCFTQRMFRHRDMYGGKMK 14730



 Score = 18.9 bits (37), Expect = 6.1
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = -1

Query: 73    FNKPTGYGSSSRRAPQTGIVDECCF 97
             F+ P    SSS  + Q  I+ + CF
Sbjct: 77233 FSFPIAGRSSSFHSQQNYILQDLCF 77159



 Score = 18.5 bits (36), Expect = 8.0
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = -3

Query: 18    DFLKVKMHTMSSSHL 32
             +FLK K+  +  SHL
Sbjct: 20546 EFLKAKIKQLVPSHL 20502


Lambda     K      H
   0.324    0.135    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,186
Number of Sequences: 0
Number of extensions: 354
Number of successful extensions: 18
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of query: 153
length of database: 26,097
effective HSP length: 52
effective length of query: 101
effective length of database: 26,045
effective search space:  2630545
effective search space used:  2630545
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 35 (19.3 bits)
S2: 35 (18.1 bits)

END