Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P05019
Subject Sequence ID: ENSG00000017427
Subject Sequence type: 3

Query= sp|P05019|IGF1B_HUMAN Insulin-like growth factor IB precursor
(IGF-IB) (Somatomedin C) (Mechano growth factor) (MGF) - Homo sapiens
(Human).
         (195 letters)

>ENSG00000017427
          Length = 78292

 Score =  134 bits (338), Expect = 1e-34
 Identities = 65/77 (84%), Positives = 66/77 (85%)
 Frame = -1

Query: 62    LQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV 121
             L  +C D      KPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV
Sbjct: 17455 LCLICAD------KPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV 17294

Query: 122   RAQRHTDMPKTQKYQPP 138
             RAQRHTDMPKTQK  PP
Sbjct: 17293 RAQRHTDMPKTQKVSPP 17243



 Score =  132 bits (331), Expect = 7e-34
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = -3

Query: 134   KYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKK 193
             +YQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKK
Sbjct: 15752 QYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKK 15573

Query: 194   GK 195
             GK
Sbjct: 15572 GK 15567



 Score =  112 bits (281), Expect = 4e-28
 Identities = 53/55 (96%), Positives = 55/55 (100%)
 Frame = -2

Query: 21    KVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNK 75
             +VKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYF+K
Sbjct: 73548 QVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFSK 73384



 Score = 52.0 bits (123), Expect = 9e-10
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = -1

Query: 1     MGKISSLPTQLFKCCFCDFLKVKM 24
             MGKISSLPTQLFKCCFCDFLKV +
Sbjct: 78127 MGKISSLPTQLFKCCFCDFLKVNI 78056



 Score = 23.5 bits (49), Expect = 0.35
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +3

Query: 70    GFYFNKPTGYGSSS 83
             GFYF +PT +  SS
Sbjct: 11766 GFYFRRPTSFSHSS 11807



 Score = 21.9 bits (45), Expect = 1.0
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = -2

Query: 4     ISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTS 44
             IS  P  L    F DFL + + T    +L  + +C+   TS
Sbjct: 46677 ISISPHPLQHLLFPDFLMITILTGMRWYLIVVLICISLMTS 46555



 Score = 21.6 bits (44), Expect = 1.3
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
 Frame = -3

Query: 34   YLALCLLTFTS---SATAGPETLCGAELVDALQFVCGDRGFY 72
            Y  +CLLTF S   ++   P  L     +++L FV  +R  Y
Sbjct: 4373 YFLMCLLTFPSKG*TSLTNPSELEDQCFLNSLTFVGVNRKQY 4248



 Score = 20.4 bits (41), Expect = 2.9
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = +1

Query: 8     PTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTF 42
             P  +F    C F   K+ ++  SHL   A     F
Sbjct: 35140 PRLIFHSVNCSFAVQKLFSLM*SHLSIFAFVAFAF 35244



 Score = 20.4 bits (41), Expect = 2.9
 Identities = 13/51 (25%), Positives = 19/51 (37%)
 Frame = +1

Query: 95    CCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTK 145
             CCF     R  +MY   +K     R  R       P T + + P T  + +
Sbjct: 14674 CCFTQRMFRHRDMYGGKMK*RHRGRRRR-------PPTSRGEEPMTEPSLR 14805



 Score = 19.6 bits (39), Expect = 5.0
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 98    RSCDLRRLEMYCAPLKPAKSAR 119
             R+C +  L   C PL   +S+R
Sbjct: 11118 RNCRIYYLRKQCFPLVGGRSSR 11183



 Score = 18.9 bits (37), Expect = 8.5
 Identities = 9/25 (36%), Positives = 11/25 (44%)
 Frame = +1

Query: 31    HLFYLALCLLTFTSSATAGPETLCG 55
             H   L  CLL+    +  G   LCG
Sbjct: 27796 HFISLDTCLLSALFVSHLGLRKLCG 27870



 Score = 18.9 bits (37), Expect = 8.5
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = -1

Query: 73    FNKPTGYGSSSRRAPQTGIVDECCF 97
             F+ P    SSS  + Q  I+ + CF
Sbjct: 77233 FSFPIAGRSSSFHSQQNYILQDLCF 77159


Lambda     K      H
   0.319    0.133    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,023
Number of Sequences: 0
Number of extensions: 440
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of query: 195
length of database: 26,097
effective HSP length: 55
effective length of query: 140
effective length of database: 26,042
effective search space:  3645880
effective search space used:  3645880
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (19.9 bits)
S2: 37 (18.9 bits)

END