Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P25942-2
Subject Sequence ID: ENSG00000101017
Subject Sequence type: 3

Query= sp_vs|P25942-2|P25942 Splice isoform II of P25942
         (203 letters)

>ENSG00000101017
          Length = 11025

 Score =  109 bits (272), Expect = 8e-28
 Identities = 48/49 (97%), Positives = 49/49 (100%)
 Frame = +2

Query: 86   NLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQI 134
            +LGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQI
Sbjct: 4343 DLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQI 4489



 Score =  107 bits (267), Expect = 3e-27
 Identities = 44/46 (95%), Positives = 45/46 (97%)
 Frame = +3

Query: 41   CQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPN 86
            C PGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDP+
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPS 4094



 Score = 75.5 bits (184), Expect = 1e-17
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +2

Query: 135  ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTR 166
            ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTR
Sbjct: 4859 ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTR 4954



 Score = 72.0 bits (175), Expect = 1e-16
 Identities = 30/32 (93%), Positives = 32/32 (100%)
 Frame = +3

Query: 164  WTRSPGSAESPGGDPHHLRDPVCHPLGAGLYQ 195
            ++RSPGSAESPGGDPHHLRDPVCHPLGAGLYQ
Sbjct: 9864 FSRSPGSAESPGGDPHHLRDPVCHPLGAGLYQ 9959



 Score = 66.6 bits (161), Expect = 6e-15
 Identities = 27/28 (96%), Positives = 28/28 (100%)
 Frame = +2

Query: 18   VHPEPPTACREKQYLINSQCCSLCQPGQ 45
            VHPEPPTACREKQYLINSQCCSLCQPG+
Sbjct: 3554 VHPEPPTACREKQYLINSQCCSLCQPGE 3637



 Score = 42.4 bits (98), Expect = 1e-07
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +3

Query: 1  MVRLPLQCVLWGCLLTAV 18
          MVRLPLQCVLWGCLLTAV
Sbjct: 78 MVRLPLQCVLWGCLLTAV 131



 Score = 22.7 bits (47), Expect = 0.095
 Identities = 11/38 (28%), Positives = 16/38 (42%)
 Frame = +3

Query: 125  CSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCH 162
            C PG  +    T  ++T C PC    F +  +    CH
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCH 4070



 Score = 21.9 bits (45), Expect = 0.16
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -2

Query: 185  VCHPLGAGLYQKGGQ 199
            VC PLGAG  Q  G+
Sbjct: 5057 VCGPLGAGTGQVAGE 5013



 Score = 20.0 bits (40), Expect = 0.61
 Identities = 12/42 (28%), Positives = 17/42 (40%)
 Frame = +2

Query: 37   CCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCH 78
            C   C P   L +  T  ++T C PC    F +  +    CH
Sbjct: 4823 CDG*CPPPHPLPA--TGVSDTICEPCPVGFFSNVSSAFEKCH 4942



 Score = 19.2 bits (38), Expect = 1.0
 Identities = 11/30 (36%), Positives = 13/30 (43%)
 Frame = -3

Query: 20   PEPPTACREKQYLINSQCCSLCQPGQKLVS 49
            P P       QYL   QC SL Q  +  +S
Sbjct: 4114 PFPTAHALGSQYLCWWQCVSLFQVSRNSLS 4025



 Score = 19.2 bits (38), Expect = 1.0
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -3

Query: 26    CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLP 61
             CR+K+  + SQC  L    Q+          T CLP
Sbjct: 10906 CRQKRGAMPSQCQPLTLTPQQ--QQHQALWPTACLP 10805



 Score = 18.9 bits (37), Expect = 1.4
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -1

Query: 164  WTRSPGSAESPGG 176
            WTRSP S +   G
Sbjct: 4362 WTRSPRSEKRRAG 4324



 Score = 18.9 bits (37), Expect = 1.4
 Identities = 7/24 (29%), Positives = 10/24 (41%)
 Frame = +2

Query: 107  EGWHCTSEACESCVLHRSCSPGFG 130
            + W       ++CVL   CS   G
Sbjct: 2120 QDWSLKLSDSQTCVLFTGCSQTVG 2191



 Score = 18.5 bits (36), Expect = 1.8
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = -1

Query: 188  PLGAGLYQKGGQEANQ 203
            P G    ++GGQEA +
Sbjct: 5499 PAGGERQRQGGQEAEK 5452



 Score = 18.1 bits (35), Expect = 2.3
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = +1

Query: 38   CSLCQPGQK 46
            C LC PG +
Sbjct: 6577 CKLCLPGSR 6603



 Score = 18.1 bits (35), Expect = 2.3
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = +2

Query: 61   PCGESEFLDTWNRETHCHQHKY 82
            P  +S +  T    TH H HK+
Sbjct: 6200 PSRDSTYKQT---NTHTHTHKH 6256



 Score = 17.7 bits (34), Expect = 3.0
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +3

Query: 98   ETDTICTC 105
            +T T+CTC
Sbjct: 8823 QTCTLCTC 8846



 Score = 17.7 bits (34), Expect = 3.0
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +1

Query: 37   CCSLCQPG 44
            CC L +PG
Sbjct: 8239 CCVLSEPG 8262



 Score = 17.7 bits (34), Expect = 3.0
 Identities = 21/73 (28%), Positives = 24/73 (32%), Gaps = 17/73 (23%)
 Frame = -2

Query: 40   LCQPGQKLVSDCTEFTETECLP---------CGESE--------FLDTWNRETHCHQHKY 82
            +C   Q     C + T   CLP         C  S         FL      TH  QH+ 
Sbjct: 8594 ICPDSQDKWQSC-DTTPPNCLPSPFSHPVFLCASSPPSVPTFLGFLQGPLSRTHHRQHQS 8418

Query: 83   CDPNLGLRVQQKG 95
            C   L L V Q G
Sbjct: 8417 C---LCLPVAQPG 8388



 Score = 17.7 bits (34), Expect = 3.0
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +3

Query: 11  WGCLL 15
           WGCLL
Sbjct: 555 WGCLL 569



 Score = 17.3 bits (33), Expect = 4.0
 Identities = 5/13 (38%), Positives = 7/13 (53%)
 Frame = -3

Query: 105  CEEGWHCTSEACE 117
            C    HC + +CE
Sbjct: 1774 CPPPAHCKTPSCE 1736



 Score = 17.3 bits (33), Expect = 4.0
 Identities = 5/24 (20%), Positives = 13/24 (54%)
 Frame = +1

Query: 51   CTEFTETECLPCGESEFLDTWNRE 74
            C+E     C+P   ++  D+ +++
Sbjct: 7216 CSELRSRHCIPASLAKEQDSVSKK 7287



 Score = 17.3 bits (33), Expect = 4.0
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 39   SLCQPGQKLVS 49
            SLC+PG   V+
Sbjct: 6530 SLCRPGWSAVA 6562



 Score = 16.9 bits (32), Expect = 5.2
 Identities = 7/23 (30%), Positives = 11/23 (47%), Gaps = 5/23 (21%)
 Frame = +1

Query: 59    CLPCGESEFLDT-----WNRETH 76
             C   G+  ++ T     W RE+H
Sbjct: 10684 CSSAGDFTWMPTGHPGGWQRESH 10752



 Score = 16.9 bits (32), Expect = 5.2
 Identities = 7/22 (31%), Positives = 10/22 (45%)
 Frame = +1

Query: 145  PCPVGFFSNVSSAFEKCHPWTR 166
            PCP+G    +  A   C  + R
Sbjct: 6145 PCPLGSQFFLEGAIVPCISFQR 6210



 Score = 16.5 bits (31), Expect = 6.8
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +3

Query: 181   LRDPVCHPLGAG 192
             LR P C   GAG
Sbjct: 10440 LRRPWCGQQGAG 10475



 Score = 16.5 bits (31), Expect = 6.8
 Identities = 6/11 (54%), Positives = 6/11 (54%)
 Frame = -3

Query: 12   GCLLTAVHPEP 22
            GCLL    P P
Sbjct: 2386 GCLLVEGPPRP 2354



 Score = 16.5 bits (31), Expect = 6.8
 Identities = 5/13 (38%), Positives = 8/13 (61%)
 Frame = -1

Query: 71   WNRETHCHQHKYC 83
            W++E H    +YC
Sbjct: 3627 WHKEQH*LFIRYC 3589



 Score = 16.5 bits (31), Expect = 6.8
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -2

Query: 168  PGSAESP 174
            PGS++SP
Sbjct: 5960 PGSSDSP 5940



 Score = 16.5 bits (31), Expect = 6.8
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = -3

Query: 138  VSDTICEPC 146
            V+ T C PC
Sbjct: 9541 VAVTTCSPC 9515



 Score = 16.2 bits (30), Expect = 8.8
 Identities = 6/19 (31%), Positives = 10/19 (52%)
 Frame = -1

Query: 22   PPTACREKQYLINSQCCSL 40
            PP     +  L+++QC  L
Sbjct: 9531 PPAHHAPRHSLLSAQCRGL 9475


Lambda     K      H
   0.320    0.136    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6614
Number of Sequences: 0
Number of extensions: 195
Number of successful extensions: 33
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of query: 203
length of database: 3675
effective HSP length: 42
effective length of query: 161
effective length of database: 3633
effective search space:   584913
effective search space used:   584913
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 30 (16.7 bits)
S2: 30 (16.2 bits)

END