Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P27512
Subject Sequence ID: ENSG00000101017
Subject Sequence type: 3

Query= sp|P27512|TNR5_MOUSE Tumor necrosis factor receptor superfamily
member 5 precursor (CD40L receptor) (B-cell surface antigen CD40)
(BP50) (CDw40) - Mus musculus (Mouse).
         (289 letters)

>ENSG00000101017
          Length = 11025

 Score = 80.9 bits (198), Expect = 4e-19
 Identities = 39/48 (81%), Positives = 43/48 (89%), Gaps = 3/48 (6%)
 Frame = +2

Query: 234   RQDPQEM---EDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQ 278
             +Q+PQE+   +D PG NTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Sbjct: 10628 KQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ 10771



 Score = 73.2 bits (178), Expect = 9e-17
 Identities = 28/47 (59%), Positives = 39/47 (82%)
 Frame = +2

Query: 88   GLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEM 134
            GLRV+++GT+E+DT+CTC+EG HCTS+ CE+C  H  C PGFGV ++
Sbjct: 4349 GLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQI 4489



 Score = 63.9 bits (154), Expect = 6e-14
 Identities = 23/46 (50%), Positives = 30/46 (65%)
 Frame = +3

Query: 41   CQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPN 86
            C PG +L S CT   +T+C PC   EF   WNRE  CHQH++C+P+
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPS 4094



 Score = 59.7 bits (143), Expect = 1e-12
 Identities = 24/38 (63%), Positives = 29/38 (76%)
 Frame = +2

Query: 135  ATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNL 172
            AT  +DT+C PCPVGFFSN SS FEKC+PWT  +  +L
Sbjct: 4859 ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRYKHSSL 4972



 Score = 38.1 bits (87), Expect = 3e-06
 Identities = 16/31 (51%), Positives = 18/31 (58%)
 Frame = +2

Query: 18   VHLGQCVTCSDKQYLHDGQCCDLCQPGSRLT 48
            VH      C +KQYL + QCC LCQPG   T
Sbjct: 3554 VHPEPPTACREKQYLINSQCCSLCQPGEMPT 3646



 Score = 33.5 bits (75), Expect = 8e-05
 Identities = 14/18 (77%), Positives = 14/18 (77%)
 Frame = +3

Query: 1  MVSLPRLCALWGCLLTAV 18
          MV LP  C LWGCLLTAV
Sbjct: 78 MVRLPLQCVLWGCLLTAV 131



 Score = 32.7 bits (73), Expect = 1e-04
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +1

Query: 187  GLKSRMRALLVIPVVMGILITIFGVFLYIKK 217
            G + R+RAL+VIP++ GIL  I  V ++I +
Sbjct: 9871 GPQDRLRALVVIPIIFGILFAILLVLVFISE 9963



 Score = 32.3 bits (72), Expect = 2e-04
 Identities = 13/22 (59%), Positives = 18/22 (81%)
 Frame = +2

Query: 166  SCEDKNLEVLQKGTSQTNVICG 187
            SCE K+L V Q GT++T+V+CG
Sbjct: 8372 SCETKDLVVQQAGTNKTDVVCG 8437



 Score = 28.5 bits (62), Expect = 0.003
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 125  CIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGT 179
            C PG  ++   TE T+T C PC    F +  +    C+    C D +   + KGT
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYC-DPSACAVGKGT 4118



 Score = 26.2 bits (56), Expect = 0.013
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = +2

Query: 169  DKNLEVLQKGTSQTNVIC 186
            D  L V QKGTS+T+ IC
Sbjct: 4343 DLGLRVQQKGTSETDTIC 4396



 Score = 23.9 bits (50), Expect = 0.064
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = +2

Query: 37   CCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCH 78
            C   C P   L +  T +  T C PC  G FS   +   +CH
Sbjct: 4823 CDG*CPPPHPLPA--TGVSDTICEPCPVGFFSNVSSAFEKCH 4942



 Score = 22.7 bits (47), Expect = 0.14
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -2

Query: 246  HNTAAPVQETLHGCQPVTQEDGKES 270
            H++  PV+ T    QPV ++DGK S
Sbjct: 4829 HHSGPPVRLTR---QPVARQDGKSS 4764



 Score = 21.9 bits (45), Expect = 0.24
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 5/76 (6%)
 Frame = -3

Query: 105  CKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETT-DTVCHPCPVGFFSNQSSLFEKCYP 163
            C    HC +  CE  A   P +P  G   + +  T +    P  +   S+ S  F     
Sbjct: 1774 CPPPAHCKTPSCERGA---PTLPKIGKSLIPSSNT*EIKRSPKSLSISSSHSP*F----- 1619

Query: 164  WTSC----EDKNLEVL 175
            W+ C    +D++LE L
Sbjct: 1618 WSFCHKTAQDQSLETL 1571



 Score = 20.8 bits (42), Expect = 0.54
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 2   VSLPRLCALWGCLL 15
           VS   L A WGCLL
Sbjct: 528 VSSYHLLASWGCLL 569



 Score = 20.4 bits (41), Expect = 0.71
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 38   CDLCQPGSR 46
            C LC PGSR
Sbjct: 6577 CKLCLPGSR 6603



 Score = 19.2 bits (38), Expect = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +1

Query: 144  HPCPVG 149
            HPCP+G
Sbjct: 6142 HPCPLG 6159



 Score = 18.9 bits (37), Expect = 2.1
 Identities = 8/15 (53%), Positives = 8/15 (53%)
 Frame = -2

Query: 21   GQCVTCSDKQYLHDG 35
            G CV    K  LHDG
Sbjct: 3698 GVCVCHQSKGGLHDG 3654



 Score = 17.3 bits (33), Expect = 6.0
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +1

Query: 37   CCDLCQPG 44
            CC L +PG
Sbjct: 8239 CCVLSEPG 8262



 Score = 17.3 bits (33), Expect = 6.0
 Identities = 8/24 (33%), Positives = 11/24 (45%)
 Frame = -3

Query: 117  EACAQHTPCIPGFGVMEMATETTD 140
            E+   HT   PGF V +   +  D
Sbjct: 3922 ESDTNHTMIRPGFRVGDSKMKVLD 3851



 Score = 17.3 bits (33), Expect = 6.0
 Identities = 6/15 (40%), Positives = 7/15 (46%)
 Frame = +3

Query: 119  CAQHTPCIPGFGVME 133
            CA    C P   +ME
Sbjct: 3621 CASQVRCQPSSPIME 3665



 Score = 16.9 bits (32), Expect = 7.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 278  QVTDSIALRPLV 289
            Q TDSI   PLV
Sbjct: 6835 QCTDSINTIPLV 6800



 Score = 16.9 bits (32), Expect = 7.9
 Identities = 6/22 (27%), Positives = 11/22 (50%)
 Frame = +1

Query: 126  IPGFGVMEMATETTDTVCHPCP 147
            +P    + ++  T  +VC  CP
Sbjct: 3409 MPNIMQVPLSVLTCTSVCSLCP 3474


Lambda     K      H
   0.321    0.135    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6812
Number of Sequences: 0
Number of extensions: 178
Number of successful extensions: 23
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of query: 289
length of database: 3675
effective HSP length: 45
effective length of query: 244
effective length of database: 3630
effective search space:   885720
effective search space used:   885720
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 31 (17.2 bits)
S2: 31 (16.5 bits)

END