Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P29803
Subject Sequence ID: ENSG00000131828
Subject Sequence type: 3

Query= sp|P29803|ODPAT_HUMAN Pyruvate dehydrogenase E1 component alpha
subunit, testis-specific form, mitochondrial precursor (EC 1.2.4.1)
(PDHE1-A type II) - Homo sapiens (Human).
         (388 letters)

>ENSG00000131828
          Length = 15915

 Score =  115 bits (288), Expect = 3e-29
 Identities = 57/81 (70%), Positives = 62/81 (76%), Gaps = 7/81 (8%)
 Frame = +2

Query: 30   NDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFC 89
            N+     +KCDL+ LEEGPPVTTVLTR +GLKYYRMM TVRRMELKADQLYKQK IRGFC
Sbjct: 5981 NNYLIPFQKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC 6160

Query: 90   HLCDGQ-------EACCVGLE 103
            HLCDGQ       E C +G E
Sbjct: 6161 HLCDGQVSGRFVVELCYLGTE 6223



 Score =  102 bits (254), Expect = 3e-25
 Identities = 46/54 (85%), Positives = 50/54 (92%)
 Frame = +2

Query: 199   QGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKV 252
             QGQI EA+NMAALWKLPC+FICENN YGMGTS ERAAAS DYYKRG+FIPGL+V
Sbjct: 11414 QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 11575



 Score = 93.2 bits (230), Expect = 2e-22
 Identities = 45/54 (83%), Positives = 47/54 (87%)
 Frame = +2

Query: 335   EIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS 388
             EI  EVRKEI+DAAQFAT DPEP LEELG+HIYSSD  FEVRGAN WIKFKSVS
Sbjct: 15557 EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 15718



 Score = 79.3 bits (194), Expect = 3e-18
 Identities = 36/43 (83%), Positives = 40/43 (93%)
 Frame = +2

Query: 95   QEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELT 137
            QEACCVGLEAGINP+DH+IT+YRAHG  +TRGLSVR ILAELT
Sbjct: 7346 QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT 7474



 Score = 67.0 bits (162), Expect = 1e-14
 Identities = 42/83 (50%), Positives = 51/83 (61%), Gaps = 8/83 (9%)
 Frame = +3

Query: 295   PGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELK-----EIGAEVRKEIDD--- 346
             P  SYRTREEIQEVRSK DPI++L+DRMVNS LA+VEELK       G +V  +      
Sbjct: 14973 PPHSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKVQSLVHGGLKVGFKSCHPWV 15152

Query: 347   AAQFATTDPEPHLEELGHHIYSS 369
             A +F    P P  + LGH  + S
Sbjct: 15153 ATEFVWVPPSPESDVLGHK*FHS 15221



 Score = 65.1 bits (157), Expect = 5e-14
 Identities = 31/52 (59%), Positives = 36/52 (69%)
 Frame = +2

Query: 170   PLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICE 221
             PLGAGIALACKY G DE+CLTLYGDGAANQ  ++  F    L+    +F  E
Sbjct: 10562 PLGAGIALACKYNGKDEVCLTLYGDGAANQVIMSLNFPKTVLFSKSLIFTVE 10717



 Score = 53.9 bits (128), Expect = 1e-10
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = +1

Query: 276   GPILMELQTYRYHGHSMSDPGVSY 299
             GPILMELQTYRYHGHSMSDPGV Y
Sbjct: 13720 GPILMELQTYRYHGHSMSDPGVRY 13791



 Score = 50.4 bits (119), Expect = 1e-09
 Identities = 25/39 (64%), Positives = 28/39 (71%)
 Frame = +3

Query: 237   SPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGK 275
             SP YY+         VDGMD+LCVREAT+FAA YCRSGK
Sbjct: 11736 SPVYYQ---------VDGMDILCVREATRFAAAYCRSGK 11825



 Score = 43.1 bits (100), Expect = 2e-07
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +2

Query: 150  SMHMYTKNFYGGNGIVGAQ 168
            SMHMY KNFYGGNGIVGAQ
Sbjct: 9185 SMHMYAKNFYGGNGIVGAQ 9241



 Score = 35.0 bits (79), Expect = 6e-05
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = +1

Query: 18   ARRVLVASRNSSNDATFEIK 37
            A RVLVASRN +NDATFEIK
Sbjct: 5380 ASRVLVASRNFANDATFEIK 5439



 Score = 19.6 bits (39), Expect = 2.4
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)
 Frame = -1

Query: 47    GP-PVTTVLTRAEGLKYYRMMLTVRRMELKAD-----QLYKQKFIRGFCH 90
             GP P T VLT + G+K   +  +V    L  D     +L+ Q  I+G  H
Sbjct: 11601 GPGPTTGVLTLSPGMKSPLL**SVLAAALSTDVPIP*RLFSQMKIQGNFH 11452



 Score = 18.1 bits (35), Expect = 7.1
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = -1

Query: 89   CHLCDGQEAC 98
            C  CD  E+C
Sbjct: 9525 CTACDSTESC 9496



 Score = 17.7 bits (34), Expect = 9.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +2

Query: 228  GTSTERAAASPDY 240
            GTS+  A  SP Y
Sbjct: 9809 GTSSSGAIPSPSY 9847


Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7016
Number of Sequences: 0
Number of extensions: 101
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of query: 388
length of database: 5305
effective HSP length: 50
effective length of query: 338
effective length of database: 5255
effective search space:  1776190
effective search space used:  1776190
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.6 bits)
S2: 34 (17.7 bits)

END