Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P35487
Subject Sequence ID: ENSG00000131828
Subject Sequence type: 3

Query= sp|P35487|ODPAT_MOUSE Pyruvate dehydrogenase E1 component alpha
subunit, testis-specific form, mitochondrial precursor (EC 1.2.4.1)
(PDHE1-A type II) - Mus musculus (Mouse).
         (391 letters)

>ENSG00000131828
          Length = 15915

 Score =  110 bits (275), Expect = 1e-27
 Identities = 53/81 (65%), Positives = 60/81 (74%), Gaps = 7/81 (8%)
 Frame = +2

Query: 33   NDATCDIKKCDLYRLEEGPPTSTVLTRAEALKYYRTMQVIRRMELKADQLYKQKFIRGFC 92
            N+     +KCDL+RLEEGPP +TVLTR + LKYYR MQ +RRMELKADQLYKQK IRGFC
Sbjct: 5981 NNYLIPFQKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC 6160

Query: 93   HLCDGQ-------EACCVGLE 106
            HLCDGQ       E C +G E
Sbjct: 6161 HLCDGQVSGRFVVELCYLGTE 6223



 Score = 99.8 bits (247), Expect = 2e-24
 Identities = 44/54 (81%), Positives = 50/54 (92%)
 Frame = +2

Query: 202   QGQVFEAYNMSALWKLPCVFICENNLYGMGTSNERSAASTDYHKKGFIIPGLRV 255
             QGQ+FEAYNM+ALWKLPC+FICENN YGMGTS ER+AASTDY+K+G  IPGLRV
Sbjct: 11414 QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 11575



 Score = 82.4 bits (202), Expect = 3e-19
 Identities = 37/43 (86%), Positives = 41/43 (95%)
 Frame = +2

Query: 98   QEACCVGLEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELT 140
            QEACCVGLEAGINPTDH+IT+YRAHGF +TRGLSV+ ILAELT
Sbjct: 7346 QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT 7474



 Score = 81.6 bits (200), Expect = 5e-19
 Identities = 34/54 (62%), Positives = 46/54 (85%)
 Frame = +2

Query: 338   EIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS 391
             EID +V+KE+EDAAQFAT DPEP +E++  ++Y  DPPFEVRGA++W+K+KS S
Sbjct: 15557 EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 15718



 Score = 57.8 bits (138), Expect = 8e-12
 Identities = 25/40 (62%), Positives = 36/40 (90%)
 Frame = +3

Query: 298   PGISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELK 337
             P  SYR+REE+  VRSKSDPIMLL++R++++NL+++EELK
Sbjct: 14973 PPHSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK 15092



 Score = 53.1 bits (126), Expect = 2e-10
 Identities = 26/53 (49%), Positives = 33/53 (62%)
 Frame = +2

Query: 172   VPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFICE 224
             VPLGAG+A ACKY    +VCL LYGDGAANQ  +   +  + L+    +F  E
Sbjct: 10559 VPLGAGIALACKYNGKDEVCLTLYGDGAANQVIMSLNFPKTVLFSKSLIFTVE 10717



 Score = 52.4 bits (124), Expect = 3e-10
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +1

Query: 279   GPIVMELQTYRYHGHSMSDPGISY 302
             GPI+MELQTYRYHGHSMSDPG+ Y
Sbjct: 13720 GPILMELQTYRYHGHSMSDPGVRY 13791



 Score = 46.2 bits (108), Expect = 2e-08
 Identities = 20/25 (80%), Positives = 24/25 (96%)
 Frame = +3

Query: 254   RVNGMDILCVREATKFAADHCRSGK 278
             +V+GMDILCVREAT+FAA +CRSGK
Sbjct: 11751 QVDGMDILCVREATRFAAAYCRSGK 11825



 Score = 44.7 bits (104), Expect = 7e-08
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +2

Query: 153  SMHMYGKNFYGGNGIVGAQV 172
            SMHMY KNFYGGNGIVGAQV
Sbjct: 9185 SMHMYAKNFYGGNGIVGAQV 9244



 Score = 23.5 bits (49), Expect = 0.17
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +1

Query: 21   ALRGLLSSLKFSNDATCDIK 40
            A R L++S  F+NDAT +IK
Sbjct: 5380 ASRVLVASRNFANDATFEIK 5439



 Score = 21.6 bits (44), Expect = 0.65
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 3/26 (11%)
 Frame = +3

Query: 277   GKGPIVMELQT---YRYHGHSMSDPG 299
             GKGP+V +L T        HS+  PG
Sbjct: 10890 GKGPVVKDLPTTYCKTIQTHSLGCPG 10967



 Score = 18.1 bits (35), Expect = 7.1
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = -1

Query: 92   CHLCDGQEAC 101
            C  CD  E+C
Sbjct: 9525 CTACDSTESC 9496


Lambda     K      H
   0.321    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7744
Number of Sequences: 0
Number of extensions: 119
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of query: 391
length of database: 5305
effective HSP length: 50
effective length of query: 341
effective length of database: 5255
effective search space:  1791955
effective search space used:  1791955
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.6 bits)
S2: 34 (17.7 bits)

END