Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P52899
Subject Sequence ID: ENSG00000131828
Subject Sequence type: 3

Query= sp|P52899|ODPA_CAEEL Probable pyruvate dehydrogenase E1
component alpha subunit, mitochondrial precursor (EC 1.2.4.1)
(PDHE1-A) - Caenorhabditis elegans.
         (397 letters)

>ENSG00000131828
          Length = 15915

 Score = 85.1 bits (209), Expect = 5e-20
 Identities = 35/54 (64%), Positives = 46/54 (85%)
 Frame = +2

Query: 195   QGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIWV 248
             QGQ+FEA NMA LW LP +F+CENN +GMGT+ ER++AST+YY RGD++PG+ V
Sbjct: 11414 QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 11575



 Score = 77.4 bits (189), Expect = 1e-17
 Identities = 35/57 (61%), Positives = 40/57 (70%)
 Frame = +2

Query: 35   CKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQ 91
            C LH+L+ GP  +  L RED LKYYR MQ +RRME  A  LYK+K IRGFCHL  GQ
Sbjct: 6008 CDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQ 6178



 Score = 56.2 bits (134), Expect = 2e-11
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = +2

Query: 134  GRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQ 164
            GR  G   GKGGSMHMY KNFYGGNGIVGAQ
Sbjct: 9149 GRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQ 9241



 Score = 55.1 bits (131), Expect = 5e-11
 Identities = 25/44 (56%), Positives = 33/44 (75%)
 Frame = +2

Query: 91   QEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTG 134
            QEAC VG++A +   D +ITAYR HG+T+  G +V E+LAELTG
Sbjct: 7346 QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTG 7477



 Score = 52.0 bits (123), Expect = 5e-10
 Identities = 26/40 (65%), Positives = 30/40 (75%)
 Frame = +3

Query: 291   PGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELK 330
             P  SYRTREEIQEVR   DPI   KDR++ S+LA+ EELK
Sbjct: 14973 PPHSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK 15092



 Score = 50.1 bits (118), Expect = 2e-09
 Identities = 22/30 (73%), Positives = 25/30 (83%)
 Frame = +2

Query: 166   PLGAGVALAMKYREQKNVCVTLYGDGAANQ 195
             PLGAG+ALA KY  +  VC+TLYGDGAANQ
Sbjct: 10562 PLGAGIALACKYNGKDEVCLTLYGDGAANQ 10651



 Score = 47.8 bits (112), Expect = 9e-09
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +1

Query: 272   GPLMMEMATYRYHGHSMSDPGTSY 295
             GP++ME+ TYRYHGHSMSDPG  Y
Sbjct: 13720 GPILMELQTYRYHGHSMSDPGVRY 13791



 Score = 40.8 bits (94), Expect = 1e-06
 Identities = 21/43 (48%), Positives = 28/43 (65%)
 Frame = +2

Query: 332   IDKEVRKEVDEALKIATSDGVLPPEALYADIYHNTPAQEIRGA 374
             ID EVRKE+++A + AT+D   P E L   IY + P  E+RGA
Sbjct: 15560 IDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGA 15688



 Score = 40.0 bits (92), Expect = 2e-06
 Identities = 18/24 (75%), Positives = 20/24 (83%)
 Frame = +3

Query: 248   VDGMDILAVREATKWAKEYCDSGK 271
             VDGMDIL VREAT++A  YC SGK
Sbjct: 11754 VDGMDILCVREATRFAAAYCRSGK 11825



 Score = 22.3 bits (46), Expect = 0.38
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 5/36 (13%)
 Frame = +3

Query: 354  PPEALYADIYHNTPA-----QEIRGATIDETIVQPF 384
            PPE +   ++ NTP+      EIRG T+   +V  F
Sbjct: 6453 PPEYVGPQVHTNTPS*FLYFLEIRGFTMLPRLVSNF 6560



 Score = 20.4 bits (41), Expect = 1.5
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +3

Query: 46    TSVTLNREDALKYYR 60
             TSV  +R+D   YYR
Sbjct: 14727 TSVRFSRKDRSSYYR 14771



 Score = 18.5 bits (36), Expect = 5.6
 Identities = 7/22 (31%), Positives = 13/22 (59%)
 Frame = -2

Query: 131  ELTGRVAGNVHGKGGSMHMYTK 152
            ELT + + +V G+G    ++ K
Sbjct: 1013 ELTAKKSSDVEGEGRGGSLFLK 948



 Score = 17.7 bits (34), Expect = 9.5
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 247   WVDGMDILA 255
             WV G+D++A
Sbjct: 15667 WVAGVDVVA 15641


Lambda     K      H
   0.317    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7260
Number of Sequences: 0
Number of extensions: 124
Number of successful extensions: 13
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of query: 397
length of database: 5305
effective HSP length: 50
effective length of query: 347
effective length of database: 5255
effective search space:  1823485
effective search space used:  1823485
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.5 bits)
S2: 34 (17.7 bits)

END