Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P52900
Subject Sequence ID: ENSG00000131828
Subject Sequence type: 3

Query= sp|P52900|ODPA_SMIMA Pyruvate dehydrogenase E1 component alpha
subunit, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A) (Fragment) -
Sminthopsis macroura (Stripe-faced dunnart).
         (363 letters)

>ENSG00000131828
          Length = 15915

 Score =  115 bits (289), Expect = 2e-29
 Identities = 56/81 (69%), Positives = 63/81 (77%), Gaps = 7/81 (8%)
 Frame = +2

Query: 5    NDATFDIKKCDVHRLEEGPPTTAVLTREEGLKYYKIMQTVRRMELKADQLYKQKIIRGFC 64
            N+     +KCD+HRLEEGPP T VLTRE+GLKYY++MQTVRRMELKADQLYKQKIIRGFC
Sbjct: 5981 NNYLIPFQKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFC 6160

Query: 65   HLYDGQ-------EACCMGLE 78
            HL DGQ       E C +G E
Sbjct: 6161 HLCDGQVSGRFVVELCYLGTE 6223



 Score =  114 bits (284), Expect = 9e-29
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = +2

Query: 174   QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGIMV 227
             QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPG+ V
Sbjct: 11414 QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRV 11575



 Score =  110 bits (276), Expect = 7e-28
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = +2

Query: 310   EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSRDPPFEVRGANQWIKYKSVS 363
             EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS DPPFEVRGANQWIK+KSVS
Sbjct: 15557 EIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 15718



 Score = 85.9 bits (211), Expect = 3e-20
 Identities = 39/43 (90%), Positives = 42/43 (97%)
 Frame = +2

Query: 70   QEACCMGLEAGINPTDHVITAYRAHGFTYTRGLPVREILAELT 112
            QEACC+GLEAGINPTDH+ITAYRAHGFT+TRGL VREILAELT
Sbjct: 7346 QEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELT 7474



 Score = 72.4 bits (176), Expect = 3e-16
 Identities = 36/40 (90%), Positives = 38/40 (95%)
 Frame = +3

Query: 270   PGVSYRTREEIQEVRSKSDPIMLLKDRMVNNNLASIEELK 309
             P  SYRTREEIQEVRSKSDPIMLLKDRMVN+NLAS+EELK
Sbjct: 14973 PPHSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELK 15092



 Score = 64.3 bits (155), Expect = 8e-14
 Identities = 32/53 (60%), Positives = 36/53 (67%)
 Frame = +2

Query: 144   VPLGVGIALACKYNEKDEICLTLYGDGAANQGQIFEAYNMAALWKLPCIFICE 196
             VPLG GIALACKYN KDE+CLTLYGDGAANQ  +   +    L+    IF  E
Sbjct: 10559 VPLGAGIALACKYNGKDEVCLTLYGDGAANQVIMSLNFPKTVLFSKSLIFTVE 10717



 Score = 52.8 bits (125), Expect = 2e-10
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = +1

Query: 251   GPMLMELQTYRYHGHSMSDPGVSY 274
             GP+LMELQTYRYHGHSMSDPGV Y
Sbjct: 13720 GPILMELQTYRYHGHSMSDPGVRY 13791



 Score = 51.6 bits (122), Expect = 5e-10
 Identities = 22/24 (91%), Positives = 24/24 (100%)
 Frame = +3

Query: 227   VDGMDVLCVREATKFAAAYCRSGK 250
             VDGMD+LCVREAT+FAAAYCRSGK
Sbjct: 11754 VDGMDILCVREATRFAAAYCRSGK 11825



 Score = 46.2 bits (108), Expect = 2e-08
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +2

Query: 125  SMHMYAKNFYGGNGIVGAQV 144
            SMHMYAKNFYGGNGIVGAQV
Sbjct: 9185 SMHMYAKNFYGGNGIVGAQV 9244



 Score = 27.3 bits (59), Expect = 0.011
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = +1

Query: 1    RNFANDATFDIK 12
            RNFANDATF+IK
Sbjct: 5404 RNFANDATFEIK 5439



 Score = 23.9 bits (50), Expect = 0.12
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 329  DPEPPLEELGYHIYSRDPPFEVRGANQW 356
            D   P+E LG H++    PF     + W
Sbjct: 9229 DAIAPVEVLGIHVHRSSFPFSTTSFSSW 9146



 Score = 21.9 bits (45), Expect = 0.46
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%)
 Frame = -1

Query: 22    GP-PTTAVLTREEGLKYYKIMQTVRRMELKAD-----QLYKQKIIRGFCH 65
             GP PTT VLT   G+K   +  +V    L  D     +L+ Q  I+G  H
Sbjct: 11601 GPGPTTGVLTLSPGMKSPLL**SVLAAALSTDVPIP*RLFSQMKIQGNFH 11452



 Score = 20.0 bits (40), Expect = 1.7
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 157   NEKDEIC 163
             NEKDEIC
Sbjct: 13515 NEKDEIC 13535


Lambda     K      H
   0.320    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6717
Number of Sequences: 0
Number of extensions: 85
Number of successful extensions: 13
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of query: 363
length of database: 5305
effective HSP length: 49
effective length of query: 314
effective length of database: 5256
effective search space:  1650384
effective search space used:  1650384
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.6 bits)
S2: 34 (17.7 bits)

END