Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: Q13696
Subject Sequence ID: ENSG00000127603
Subject Sequence type: 3

Query= tr|Q13696|Q13696_HUMAN ACF7 protein (Fragment) OS=Homo sapiens
GN=ACF7 PE=2 SV=1
         (385 letters)

>ENSG00000127603
          Length = 402951

 Score =  123 bits (308), Expect = 4e-30
 Identities = 57/60 (95%), Positives = 59/60 (98%)
 Frame = +3

Query: 195    LHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYR 254
              + +QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYR
Sbjct: 198030 IFWQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYR 198209



 Score =  100 bits (248), Expect = 3e-23
 Identities = 58/107 (54%), Positives = 58/107 (54%), Gaps = 49/107 (45%)
 Frame = +1

Query: 328    EVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELK-------------------- 367
              EVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELK                    
Sbjct: 199900 EVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKVKSRT*IFLVKSF*GVSLQA 200079

Query: 368    -----------------------------ALYNQYIHFKETEILAKE 385
                                           ALYNQYIHFKETEILAKE
Sbjct: 200080 YHCWLLGEVV*KIGSYSLCPFIHQILIL*ALYNQYIHFKETEILAKE 200220



 Score = 83.2 bits (204), Expect(2) = 1e-34
 Identities = 43/50 (86%), Positives = 45/50 (90%)
 Frame = +1

Query: 242    DGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAERLGVTRLLDAE 291
              DG +  AL+  YRPDLVDMERVQIQSNRENLEQAFEVAERLGVTRLLDAE
Sbjct: 198985 DGGVSCALLDFYRPDLVDMERVQIQSNRENLEQAFEVAERLGVTRLLDAE 199134



 Score = 75.9 bits (185), Expect(2) = 1e-34
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +3

Query: 292    DVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISAT 327
              DVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISAT
Sbjct: 199242 DVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISAT 199349



 Score = 71.2 bits (173), Expect = 2e-14
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +1

Query: 167    QVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDI 202
              QVKLVNIRNDDITDGNPKLTLGLIWTIILHFQ+  +
Sbjct: 173767 QVKLVNIRNDDITDGNPKLTLGLIWTIILHFQVGHV 173874



 Score = 69.3 bits (168), Expect = 6e-14
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +2

Query: 53  PCPPGDTLPWNLPLHEQKKRKSQDSVLDP 81
           PCPPGDTLPWNLPLHEQKKRKSQDSVLDP
Sbjct: 158 PCPPGDTLPWNLPLHEQKKRKSQDSVLDP 244



 Score = 63.2 bits (152), Expect = 5e-12
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 111    KVRKHINDLYEDLRDGHNLISLLEVLSGIKL 141
              +VRKHINDLYEDLRDGHNLISLLEVLSGIKL
Sbjct: 165845 QVRKHINDLYEDLRDGHNLISLLEVLSGIKL 165937



 Score = 58.5 bits (140), Expect = 1e-10
 Identities = 27/28 (96%), Positives = 28/28 (100%)
 Frame = +2

Query: 142    PREKGRMRFHRLQNVQIALDFLKQRQVK 169
              PREKGRMRFHRLQNVQIALDFLKQRQV+
Sbjct: 170132 PREKGRMRFHRLQNVQIALDFLKQRQVR 170215



 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +3

Query: 97     QKKTFTKWVNKHLMKV 112
              QKKTFTKWVNKHLMKV
Sbjct: 147033 QKKTFTKWVNKHLMKV 147080



 Score = 30.8 bits (68), Expect = 0.025
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 334    QEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKA 368
              Q+YQ  V+ L+PWI+     MS+     +PV+L++
Sbjct: 303392 QKYQWHVEDLVPWIEDCKAKMSELRVTLDPVQLES 303496



 Score = 24.3 bits (51), Expect = 2.3
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = -2

Query: 303    VITYVSSIYDAFPKVPEGGEGISATEVDSRW 333
              +  YV  I  +FP  PE        E+  RW
Sbjct: 181943 ISAYVRPIRPSFPSAPEKNWSREGAEISVRW 181851



 Score = 22.7 bits (47), Expect = 6.8
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 1 ITSPWAPR 8
         ITSPWAPR
Sbjct: 1 ITSPWAPR 24


Lambda     K      H
   0.318    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 159,961
Number of Sequences: 0
Number of extensions: 2051
Number of successful extensions: 23
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of query: 385
length of database: 134,317
effective HSP length: 72
effective length of query: 313
effective length of database: 134,245
effective search space: 42018685
effective search space used: 42018685
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

END