Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: Q28203
Subject Sequence ID: ENSG00000101017
Subject Sequence type: 3

Query= sp|Q28203|TNR5_BOVIN Tumor necrosis factor receptor superfamily
member 5 precursor (CD40L receptor) (B-cell surface antigen CD40)
(Fragment) - Bos taurus (Bovine).
         (269 letters)

>ENSG00000101017
          Length = 11025

 Score = 80.5 bits (197), Expect = 5e-19
 Identities = 30/46 (65%), Positives = 39/46 (84%)
 Frame = +3

Query: 41   CPPGQKLVNDCTEVSKTECQSCGKGEFLSTWNREKYCHEHRYCNPN 86
            C PGQKLV+DCTE ++TEC  CG+ EFL TWNRE +CH+H+YC+P+
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPS 4094



 Score = 78.2 bits (191), Expect = 3e-18
 Identities = 34/54 (62%), Positives = 38/54 (70%)
 Frame = +2

Query: 86   NLGLRIQSEGTLNTDTICVCVEGQHCTSHTCESCTPHSLCLPGFGVKQIATGLL 139
            +LGLR+Q +GT  TDTIC C EG HCTS  CESC  H  C PGFGVKQI   L+
Sbjct: 4343 DLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIGKWLI 4504



 Score = 67.4 bits (163), Expect = 5e-15
 Identities = 28/39 (71%), Positives = 32/39 (82%)
 Frame = +2

Query: 135  ATGLLDTVCEPCPLGFFSNVSSAFEKCHRWTSCERKGLV 173
            ATG+ DT+CEPCP+GFFSNVSSAFEKCH WT  +   LV
Sbjct: 4859 ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRYKHSSLV 4975



 Score = 48.1 bits (113), Expect = 3e-09
 Identities = 19/28 (67%), Positives = 21/28 (75%)
 Frame = +2

Query: 18   VHSEPATACGEKQYPVNSLCCDLCPPGQ 45
            VH EP TAC EKQY +NS CC LC PG+
Sbjct: 3554 VHPEPPTACREKQYLINSQCCSLCQPGE 3637



 Score = 38.5 bits (88), Expect = 2e-06
 Identities = 17/22 (77%), Positives = 17/22 (77%)
 Frame = +2

Query: 166  SCERKGLVEQHVGTNKTDVVCG 187
            SCE K LV Q  GTNKTDVVCG
Sbjct: 8372 SCETKDLVVQQAGTNKTDVVCG 8437



 Score = 36.2 bits (82), Expect = 1e-05
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +1

Query: 187  GFQSRMRTLVVIPVTMGVLFAVLLV 211
            G Q R+R LVVIP+  G+LFA+LLV
Sbjct: 9871 GPQDRLRALVVIPIIFGILFAILLV 9945



 Score = 33.9 bits (76), Expect = 6e-05
 Identities = 14/18 (77%), Positives = 15/18 (83%)
 Frame = +3

Query: 1  MVRLPLQCLFWGFFLTAV 18
          MVRLPLQC+ WG  LTAV
Sbjct: 78 MVRLPLQCVLWGCLLTAV 131



 Score = 25.8 bits (55), Expect = 0.016
 Identities = 12/44 (27%), Positives = 18/44 (40%)
 Frame = +3

Query: 125  CLPGFGVKQIATGLLDTVCEPCPLGFFSNVSSAFEKCHRWTSCE 168
            C PG  +    T   +T C PC    F +  +    CH+   C+
Sbjct: 3957 CFPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD 4088



 Score = 20.0 bits (40), Expect = 0.86
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 262  AGRPGGRQ 269
            AGRPGGR+
Sbjct: 5476 AGRPGGRK 5453



 Score = 19.2 bits (38), Expect = 1.5
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = -3

Query: 214  CIRNITKKRQLRPCTLWLKGRIPWRR 239
            C R +     L P  L  KGR PW++
Sbjct: 4732 CPRQLQSPGGLLP--LPFKGRSPWQK 4661



 Score = 18.5 bits (36), Expect = 2.5
 Identities = 6/17 (35%), Positives = 8/17 (47%)
 Frame = -3

Query: 105  CVEGQHCTSHTCESCTP 121
            C    HC + +CE   P
Sbjct: 1774 CPPPAHCKTPSCERGAP 1724



 Score = 18.1 bits (35), Expect = 3.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = +2

Query: 64   KGEFLSTWN 72
            +G+F S WN
Sbjct: 7796 RGQFCSLWN 7822



 Score = 18.1 bits (35), Expect = 3.3
 Identities = 7/17 (41%), Positives = 9/17 (52%)
 Frame = -1

Query: 25   ACGEKQYPVNSLCCDLC 41
            AC   +  V+ LC D C
Sbjct: 8406 ACCTTRSLVSQLCTDTC 8356



 Score = 18.1 bits (35), Expect = 3.3
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 118  SCTPHSLCLP 127
            +CTPH   LP
Sbjct: 9851 ACTPHLQFLP 9822



 Score = 17.7 bits (34), Expect = 4.2
 Identities = 7/17 (41%), Positives = 8/17 (47%)
 Frame = +1

Query: 145  PCPLGFFSNVSSAFEKC 161
            PCPLG    +  A   C
Sbjct: 6145 PCPLGSQFFLEGAIVPC 6195



 Score = 17.3 bits (33), Expect = 5.5
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 206  FAVLLVSACIRNITKKRQLRPCTLWLK 232
            FA L     +RN TKK      ++WL+
Sbjct: 1459 FAHLYNGGVVRNQTKKTG----SVWLR 1391



 Score = 17.3 bits (33), Expect = 5.5
 Identities = 7/25 (28%), Positives = 12/25 (48%)
 Frame = +2

Query: 69   STWNREKYCHEHRYCNPNLGLRIQS 93
            S W+  +     R  NP+   +I+S
Sbjct: 2279 SLWS*NRVNASQRLANPSFKTKIKS 2353



 Score = 16.9 bits (32), Expect = 7.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 20   SEPATAC 26
            SEP TAC
Sbjct: 1391 SEPNTAC 1411



 Score = 16.5 bits (31), Expect = 9.5
 Identities = 5/12 (41%), Positives = 7/12 (58%)
 Frame = +2

Query: 153   NVSSAFEKCHRW 164
             N   +F+K  RW
Sbjct: 10109 NPGQSFDKLGRW 10144


Lambda     K      H
   0.326    0.139    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6805
Number of Sequences: 0
Number of extensions: 185
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of query: 269
length of database: 3675
effective HSP length: 44
effective length of query: 225
effective length of database: 3631
effective search space:   816975
effective search space used:   816975
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 31 (17.4 bits)
S2: 31 (16.5 bits)

END