Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: Q8UW79
Subject Sequence ID: ENSG00000139618
Subject Sequence type: 3

Query= tr|Q8UW79|Q8UW79_CHICK Tumor suppressor BRCA2 - Gallus gallus
(Chicken).
         (3397 letters)

>ENSG00000139618
          Length = 84189

 Score =  201 bits (512), Expect = 2e-53
 Identities = 351/1452 (24%), Positives = 579/1452 (39%), Gaps = 129/1452 (8%)
 Frame = +1

Query: 910   VAEEFLDCIDNSLNEVVSEEDRQVAPVYFNTKPIESLEHKGKSSGDLNACSSSLSFGGFQ 969
             +AEE  + +   +   + ++ +    +  +  P ++ ++  K +G L   S+    G F+
Sbjct: 21727 LAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPISNHSFGGSFR 21906

Query: 970   TASNKQIKFSESSIAKGKMLFKDIENEFFEASSMERVRNFSNRVQKENIFSSDLESKTGS 1029
             TASNK+IK SE +I K KM FKDIE ++  + +   +    N +  +N           +
Sbjct: 21907 TASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEI---VNTLALDNQKKLSKPQSINT 22077

Query: 1030  TSSGLQTRCMQYIPRKVDLCKNS---PRNQLSVQE--PNQSLTASQEAEIAELSNILEET 1084
              S+ LQ+  +      V  CKNS   P+   S Q+   N +LT SQ+AEI ELS ILEE+
Sbjct: 22078 VSAHLQSSVV------VSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEES 22239

Query: 1085  GSQFEFTQFRKQSNMIQSHIQQFGATNVENASEAGEDTNFYSTLKSENHVINDEYCSKSK 1144
             GSQFEFTQFRK S ++Q           ++  E  E  N  + LK+ +    D       
Sbjct: 22240 GSQFEFTQFRKPSYILQ-----------KSTFEVPE--NQMTILKTTSEECRDADLHVIM 22380

Query: 1145  NENECKMVEYEK--EDTVVFHKNKREVTFTNLDRNESRISSHESCPVPLRDSFS-NFVGF 1201
             N      V+  K  E TV   +      F  L +N+     ++S    L D     F GF
Sbjct: 22381 NAPSIGQVDSSKQFEGTVEIKRK-----FAGLLKND----CNKSASGYLTDENEVGFRGF 22533

Query: 1202  TSAGGKKINISKAALTRSAEXXXXXXXXXXXXXS-----SGTNTRCCNSDERV--SSNWN 1254
              SA G K+N+S  AL ++ +             +     S ++++C +S   +    N N
Sbjct: 22534 YSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHN 22713

Query: 1255  FLRCQTKEDEGGILCVPNIK-SIGPISHHSEKKYAENISSPCEENTENWTEILSDNVDFS 1313
                   K ++  ++   NI+ + G       + Y  N  +  E+N        S N++F 
Sbjct: 22714 DKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTEN--EDNKYTAASRNSHNLEFD 22887

Query: 1314  CTNGGYSASGMRNSPSS---FKKPHQNC-KNSDQFLNQGNSEVEGCLQEDTSYLICLGDN 1369
              ++   + +   +   +   F   H  C K S QF+ +GN+++    +ED S L  L   
Sbjct: 22888 GSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQI----KEDLSDLTFL--E 23049

Query: 1370  ITSAEEHDLNVSDEMENLSPNQKEDRKQEDEHLLLNRQAADTDAVXXXXXXXXXXXXXXN 1429
             +  A+E     +   E L+  + E   ++ E      Q A    +              +
Sbjct: 23050 VAKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFD 23229

Query: 1430  VQCGE-----RDTGVSEKSSKQKTNSVSVEGEDSTYKNLFVSESEIKIGS-NQRHQVPSE 1483
              +  E      ++ +     K K + +S E E    K+  + ES + +G+ NQ      +
Sbjct: 23230 QKPEELHNFSLNSELHSDIRKNKMDILSYE-ETDIVKHKILKES-VPVGTGNQLVTFQGQ 23403

Query: 1484  QEMDVDKNKVKGTYLTGFCTASGKKITIADGFLAKAEEFFSENNVDLGKDDNDCFEDCLR 1543
              E D    K+K   L GF TASGKK+ IA   L K +  F E   + G  +   F     
Sbjct: 23404 PERD---EKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEK--EQGTSEITSFSHQWA 23568

Query: 1544  KCNK--SYVKDRDLC--------------MDSTAHCDADVLNFKDKLIPQEPGDRLKQTI 1587
             K  K     KD +L               M ++ + D ++++ +  + P+   D L +  
Sbjct: 23569 KTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLCRQT 23748

Query: 1588  EESPIIQAVNHDSIKVGAFINVDEDCERNLAAPCANKEAY-VRPGRSEVESLPVHGNNSL 1646
             E     +++    +KV    NV+++  ++ A    N+  Y V    +           S+
Sbjct: 23749 ENLKTSKSI---FLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSV 23919

Query: 1647  SRTLLLEDRK-------------------------------RFAERDVEYSATKRDNPES 1675
             S+T LLE +K                                 AE D  + + K+D   S
Sbjct: 23920 SQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLS 24099

Query: 1676  KPDSSLKCATSLHLTKV---SSHLADNSVPGGIIQTVSAEDSCKSNQSFLLPRGSVPRST 1732
               +SS+  + S H  +V   S +L+ N +  G I+ V      + N SF     +V +  
Sbjct: 24100 --NSSMSNSYSYHSDEVYNDSGYLSKNKLDSG-IEPVLKNVEDQKNTSFSKVISNV-KDA 24267

Query: 1733  SPYLNCGNKEIDLKRL---NEPCSNTDSFTNTVDNAHQEQSEFDLPEDETNLTCLQETSL 1789
             + Y    N++I ++ L   + PC N ++    +  +    + F++               
Sbjct: 24268 NAYPQTVNEDICVEELVTSSSPCKNKNA---AIKLSISNSNNFEVG-------------- 24396

Query: 1790  NAESQKSDLKQVFSTAKGKAVSVSESALASIRQMFQTDCDASVKSEIETKSGTNQTAIAG 1849
                         F  A GK V VS   +  ++ +F       +K   E KS   QT I  
Sbjct: 24397 ---------PPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMA 24549

Query: 1850  SSSFSIHAGGPGFATFLDTRKSEMNVAAPHFINGNGNLIENNHQGANMFADADSVPGFQ- 1908
                        G    LD  +  +     H    N     ++H+   +FAD  S    Q 
Sbjct: 24550 -----------GCYEALDDSEDIL-----HNSLDNDECSTHSHK---VFADIQSEEILQH 24672

Query: 1909  ---MQCFEQKSKLLGHFPVPDKQMEQS--------------GPSGNLGFFSTASGKPVQL 1951
                M   E+ SK+       D  +E S                +   G FSTASGK VQ+
Sbjct: 24673 NQNMSGLEKVSKI----SPCDVSLETSDICKCSIGKLHKSVSSANTCGIFSTASGKSVQV 24840

Query: 1952  SEESLKKARQLFSEMEGSHSSGLQDAHLLEDVEKSTNHGEVFPREMQLLLPRGKENASTD 2011
             S+ SL+ ARQ+FSE+E S             + KS  H +   RE    + R  E+  + 
Sbjct: 24841 SDASLQNARQVFSEIEDSTKQVFSKV-----LFKSNEHSDQLTREENTAI-RTPEHLISQ 25002

Query: 2012  K-------ISSPALGFSTASGKQVTISESAYQKAMAILKEADGFL---------SSELGV 2055
             K        SS   GFSTASGKQV+I ES+  K   +L+E D            +S   V
Sbjct: 25003 KGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQNV 25182

Query: 2056  TNELCEI-KESGQHAEYLTGKVIXXXXXXXXXXXXLDLKSIHPEKMKSLPSTHRVKITEY 2114
             +  L  + K + +H   +  ++             L+++        S  + H +K++ Y
Sbjct: 25183 SKILPRVDKRNPEHC--VNSEMEKTCSKEFKLSNNLNVEG------GSSENNHSIKVSPY 25338

Query: 2115  VPHSKRNSQSAPFKNSFE--------QEETRFFRKGELNLGIKTESESDLCSATSKAEIN 2166
             +   +++ Q                  +E    +  ++ +G KTE+ SD+   T+    +
Sbjct: 25339 LSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIG-KTETFSDVPVKTNIEVCS 25515

Query: 2167  IF-QTPKDYLKTEAVESAKAFMEDD-LSDSGVQVKSAQSFGKMSDN----FQNKPFGKRH 2220
              + +  ++Y +TEAVE AKAFMEDD L+DS +   +  S     +N      N   GKR 
Sbjct: 25516 TYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKR- 25692

Query: 2221  LDEKDSHGEPPI 2232
                    GEP I
Sbjct: 25693 ------RGEPLI 25710



 Score =  164 bits (415), Expect = 3e-42
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)
 Frame = +1

Query: 2590  NRCLTPETVLLQLKYRYDLEIDKSKRSAIKKITERDDAAGKTLVLCVSKVLSLNTAVSPS 2649
             +R   P+  +    +RYD EID+S+RSAIKKI ERDD A KTLVLCVS ++SL+  +S +
Sbjct: 47653 SRVTLPKICIFVFTFRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISET 47832

Query: 2650  NSNNNTEGE-KAAAIIEVTDGWYGIRALLDPPLKAFLHRRRLTVGQKIIVHGAELIGSPN 2708
             +SN  +  + +  AIIE+TDGWY ++A LDPPL A L   RLTVGQKII+HGAEL+GSP+
Sbjct: 47833 SSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPD 48012

Query: 2709  GCTPLEAPDSLMLKI 2723
              CTPLEAP+SLMLK+
Sbjct: 48013 ACTPLEAPESLMLKV 48057



 Score =  112 bits (279), Expect = 2e-26
 Identities = 48/59 (81%), Positives = 53/59 (89%)
 Frame = +2

Query: 2547  YRALCDTPGVDPKLITEAWVYNHYRWIVWKLAAMEVCFPHKFANRCLTPETVLLQLKYR 2605
             +RALCDTPGVDPKLI+  WVYNHYRWI+WKLAAME  FP +FANRCL+PE VLLQLKYR
Sbjct: 47039 FRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR 47215



 Score =  103 bits (256), Expect = 9e-24
 Identities = 46/63 (73%), Positives = 54/63 (85%)
 Frame = +2

Query: 2486  LYTYGVSKHCIQVNSTNAESFQFLIEEFFSKEYLLAGNGIHLADGGWLIPTDEGKAGKKE 2545
             LYTYGVSKHCI++NS NAESFQF  E++F KE L  G GI LADGGWLIP+++GKAGK+E
Sbjct: 42263 LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE 42442

Query: 2546  FYR 2548
             FYR
Sbjct: 42443 FYR 42451



 Score =  102 bits (255), Expect = 1e-23
 Identities = 60/161 (37%), Positives = 94/161 (58%), Gaps = 4/161 (2%)
 Frame = +3

Query: 3170  SSKIETKHPSPLSASTPNTKLF--PQGSAITPSSAVSSE--NHPRNSKKRKAVDFLSCIP 3225
             S   E  + SPLS      K    P  + +T  S    +  +  +N KKR+A+DFLS +P
Sbjct: 82689 SPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLP 82868

Query: 3226  APPPLTPLCSIISPSLKKAFQPPRRLGSQHSKLSKETNPNAGCVTPSRRLREAVQLPDND 3285
              PPP++P+C+ +SP+ +KAFQPPR  G+++    K+   N+  +TP ++  E + L +++
Sbjct: 82869 LPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNE-ISLLESN 83045

Query: 3286  LVADEELAMINTQALINTVPEEKKMDYVNEDGTRATNLSGD 3326
              +ADEELA+INTQAL++    EK+   V+E    A   S D
Sbjct: 83046 SIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSED 83168



 Score =  102 bits (253), Expect = 2e-23
 Identities = 58/133 (43%), Positives = 78/133 (58%), Gaps = 32/133 (24%)
 Frame = +1

Query: 2932  VILSIWRPLLDVCSLLKEGSRYRICQLSTSQSKGRSDSTNVQLSATKKTRYLQLS----- 2986
             VILSIWRP  D+ SLL EG RYRI  L+TS+SK +S+  N+QL+ATKKT+Y QL      
Sbjct: 64270 VILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVQTFH 64449

Query: 2987  --------------------------VSQKMLQQIFFPRKALKFTSLLDPSYQPPCAEVD 3020
                                       VS ++L QI+ PR+ L F+  LDP +QP C+EVD
Sbjct: 64450 CNFSVLISAC*FMESPYVEFLFCFL*VSDEILFQIYQPREPLHFSKFLDPDFQPSCSEVD 64629

Query: 3021  VVGVVIS-ISRTG 3032
             ++G V+S + +TG
Sbjct: 64630 LIGFVVSVVKKTG 64668



 Score = 95.1 bits (235), Expect = 2e-21
 Identities = 41/54 (75%), Positives = 49/54 (90%)
 Frame = +2

Query: 2721  LKIAANSTRCARWYTKLGFHRDPRPFPLPLSSLYSEGGTVGCIDVVVQRTYPIQ 2774
             ++I+ANSTR ARWYTKLGF  DPRPFPLPLSSL+S+GG VGC+DV++QR YPIQ
Sbjct: 54917 VQISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPIQ 55078



 Score = 92.4 bits (228), Expect = 2e-20
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 3032  GFSNMVYLSDESYNLVAIKIWADLRHFAIEDIVVRCSFIAASNLQWQSEFRSEIPVLLAG 3091
             G +  VYLSDE YNL+AIK W DL     EDI+     IAASNLQW+ E +S +  L AG
Sbjct: 79209 GLAPFVYLSDECYNLLAIKFWIDLN----EDIIKPHMLIAASNLQWRPESKSGLLTLFAG 79376

Query: 3092  DLSAFSASPKENHLQEKFNELRRMIE 3117
             D S FSASPKE H QE FN+++  +E
Sbjct: 79377 DFSVFSASPKEGHFQETFNKMKNTVE 79454



 Score = 87.0 bits (214), Expect = 6e-19
 Identities = 41/71 (57%), Positives = 57/71 (80%)
 Frame = +1

Query: 2861  YMEGYLSEDQLKALNAHKQLMNDKKQTRIREEFKKAVESAEQEKHGFSKRDVSTVWKLFV 2920
             + +GY SE+QL+ALN H+Q++NDKKQ +I+ E +KA+ESAEQ++ G S RDV+TVWKL +
Sbjct: 63829 WSQGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLS-RDVTTVWKLRI 64005

Query: 2921  VDYRKQEKHRG 2931
             V Y K+EK  G
Sbjct: 64006 VSYSKKEKDSG 64038



 Score = 82.4 bits (202), Expect = 2e-17
 Identities = 47/86 (54%), Positives = 60/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query: 23   DLGPISLDWFEELSSEAPPYEPKLLGEPEGPIGWFD-QTFKTPKAKSSTDSQLASTPLIF 81
            DLGPISL+WFEELSSEAPPY  +   E E     ++   FKTP+ K S  +QLASTP+IF
Sbjct: 3597 DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSY-NQLASTPIIF 3773

Query: 82   KEQN-TMPPFSSPGKELDQKKMETSR 106
            KEQ  T+P + SP KELD+ K++  +
Sbjct: 3774 KEQGLTLPLYQSPVKELDKFKLDLGK 3851



 Score = 65.9 bits (159), Expect = 2e-12
 Identities = 32/55 (58%), Positives = 41/55 (74%)
 Frame = +1

Query: 2425  NMMANLHCARDLQEMRIKKKYRQNISPQPGSLYVTKTSARNRISLKTAVEEETPS 2479
             +++ +L  ARD+Q+MRIKKK RQ + PQPGSLY+ KTS   RISLK AV  + PS
Sbjct: 40948 DLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPS 41112



 Score = 63.5 bits (153), Expect = 8e-12
 Identities = 30/48 (62%), Positives = 36/48 (75%)
 Frame = +1

Query: 174   TPKRISESLGAEVDPEMSWTSSLATPPTLGVTVIIARENDSISGAKQQ 221
             TPK ISESLGAEVDP+MSW+SSLATPPTL  TV+I   +  +   K +
Sbjct: 11029 TPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGNNSKCVFTRKSR 11172



 Score = 60.5 bits (145), Expect = 6e-11
 Identities = 28/50 (56%), Positives = 33/50 (66%)
 Frame = +1

Query: 2773  IQWMEKTSAGSYVFRNSXXXXXXXXXXXXDQQKKLEALFAKIQAEFEKHE 2822
             +QWMEKTS+G Y+FRN              QQK+LEALF KIQ EFE+HE
Sbjct: 55471 LQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHE 55620



 Score = 60.5 bits (145), Expect = 6e-11
 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +2

Query: 2283  TTKERQEVRNPTLTLPDQDLKGFKSIPAVFQHCALRQSSSGASGLFTP-HKAVAKDSEET 2341
             TTKERQE++NP  T P Q+   F S   +++H  L +SSS  +    P ++  A  +E+ 
Sbjct: 39383 TTKERQEIQNPNFTAPGQE---FLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKM 39553

Query: 2342  RSLCKSGKAVKTFVPPFKTKLTLSTGEQ 2369
             R L  +G+  K FVPPFKTK      EQ
Sbjct: 39554 RHLITTGRPTKVFVPPFKTKSHFHRVEQ 39637



 Score = 53.1 bits (126), Expect = 1e-08
 Identities = 23/32 (71%), Positives = 29/32 (90%)
 Frame = +2

Query: 2832  SRIVTRQQIHNLQDGAELYEAIQNAADPSYME 2863
             SR +TRQQ+  LQDGAELYEA++NAADP+Y+E
Sbjct: 61217 SRALTRQQVRALQDGAELYEAVKNAADPAYLE 61312



 Score = 37.0 bits (84), Expect = 8e-04
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 12/141 (8%)
 Frame = +1

Query: 889   TLSIKSSENPQAAAWNNESIEVAEEFLDCIDNSLNEVVSE------EDRQVAPVYFNTKP 942
             T  I S+ + ++   ++ S++ A +    I++S  +V S+      E         NT  
Sbjct: 24796 TCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTA- 24972

Query: 943   IESLEHKGKSSGDLNACSSSLSFGGFQTASNKQIKFSESSIAKGKMLFKDIE------NE 996
             I + EH     G      +S +F GF TAS KQ+   ESS+ K K + ++ +      + 
Sbjct: 24973 IRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSL 25152

Query: 997   FFEASSMERVRNFSNRVQKEN 1017
              +  +S + V     RV K N
Sbjct: 25153 HYSPTSRQNVSKILPRVDKRN 25215



 Score = 36.2 bits (82), Expect = 0.001
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = +3

Query: 2259  GIFKDRRKFMYHVPLKPVTCQP 2280
             G  KDRR FM+HV L+P+TC P
Sbjct: 31347 GTIKDRRLFMHHVSLEPITCVP 31412



 Score = 35.8 bits (81), Expect = 0.002
 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = +2

Query: 2228  GEPPIKRQLLLEFEK-MKIPPKSVKPLKSTPDG 2259
             GEP IKR LL EF++ ++   KS+K  KSTPDG
Sbjct: 29078 GEPSIKRNLLNEFDRIIENQEKSLKASKSTPDG 29176



 Score = 28.9 bits (63), Expect = 0.21
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 1    MAYKSGKRPTFFEVFKAHCSDSDL 24
            M   S +RPTFFE+FK  C+ + +
Sbjct: 982  MPIGSKERPTFFEIFKTRCNKAGI 1053



 Score = 28.1 bits (61), Expect = 0.36
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +2

Query: 3118  NVDSFCSDAESKLMNLLQRN 3137
             N+D  C++AE+KLM++L  N
Sbjct: 81419 NIDILCNEAENKLMHILHAN 81478



 Score = 24.3 bits (51), Expect = 5.2
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +3

Query: 2632  LVLCVSKVLSLNTAVSPSNSNNNTEGEK 2659
             L LC++K  S++T VS   ++ + +GEK
Sbjct: 82722 LSLCMAKRKSVSTPVSAQMTSKSCKGEK 82805



 Score = 23.9 bits (50), Expect = 6.7
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = -1

Query: 36    SSEAPPYEPKLLG 48
             SS+ PP+ PKLLG
Sbjct: 60828 SSDPPPWTPKLLG 60790



 Score = 23.5 bits (49), Expect = 8.8
 Identities = 8/32 (25%), Positives = 17/32 (53%)
 Frame = +1

Query: 1606  FINVDEDCERNLAAPCANKEAYVRPGRSEVES 1637
             F+ +   C+  +  PC+  +  + PGR+ + S
Sbjct: 38131 FLPLKYTCKNKILLPCSPAKQCLAPGRNSLNS 38226


Lambda     K      H
   0.312    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 295,429
Number of Sequences: 0
Number of extensions: 4332
Number of successful extensions: 58
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of query: 3397
length of database: 28,063
effective HSP length: 78
effective length of query: 3319
effective length of database: 27,985
effective search space: 92882215
effective search space used: 92882215
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 49 (23.5 bits)

END