Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: Q8VHD0
Subject Sequence ID: ENSG00000139618
Subject Sequence type: 3

Query= tr|Q8VHD0|Q8VHD0_MOUSE Breast cancer 2 - Mus musculus (Mouse).
         (3329 letters)

>ENSG00000139618
          Length = 84189

 Score = 1249 bits (3231), Expect = 0.0
 Identities = 812/1679 (48%), Positives = 1071/1679 (63%), Gaps = 74/1679 (4%)
 Frame = +1

Query: 626   GIPDSSDKKRCLPNDPEEP--SLTNSFGTATSK----EISYIHALISQDLNDKEAIVIEE 679
             G+  SS K+ C  ND EEP  SLT+SFGT   K    E    + +ISQDL+ KEA   +E
Sbjct: 20785 GLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKE 20964

Query: 680   KPQPYTAREADFLLCLPERTCENDQKSPKVSNGKEKVLVSACLP---SAVQLSSISFESQ 736
             K Q +   EAD L CL E  CEND KS KVS+ KE+VL +AC P   S V+ S   F+SQ
Sbjct: 20965 KLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQ 21144

Query: 737   ENPLGDHNGXXXXXXXXXXXXXXXXADMVSREKMC-KMPEKLQCESCKVNIELSKNI-LE 794
             ++ L DH                    M+SR K   KM +KL+  + + ++EL+KNI +E
Sbjct: 21145 KSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPME 21324

Query: 795   VNE-ICILSENSKTPGLLPPGENIIEVASSMKSQFNQNAKI-VIQKDQKGSPFISEVAVN 852
              N+ +C L+EN K   LLPP + +   + S K QFNQN  + VIQK+Q+ +  IS++ VN
Sbjct: 21325 KNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVN 21504

Query: 853   MNSEELFPDSGNNFAFQVTNKCNKPDLGSSVELQEEDLSHTQGPSLKNSPMXXXXXXXXX 912
              +SEELF D+ NNF FQV N+ N   LG++ EL E DL+    P  KNS M         
Sbjct: 21505 PDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDK 21684

Query: 913   XXXXXLITKDSDSLAVVHDYTEKSRNNIEQHQKGTEDKDFKSNSSLNMKS--DGNSDCSD 970
                   I KD     +V+   E+++N+++QH K T  +D KS+ SLN+    + N+D  +
Sbjct: 21685 QATQVSIKKD-----LVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMN 21849

Query: 971   KWSEFLDPVLNHNFGGSFRTASNKEIKLSEHNVKKSKMFFKDIEEQYPTRLACIDIVNTL 1030
             KW+  L P+ NH+FGGSFRTASNKEIKLSEHN+KKSKMFFKDIEEQYPT LAC++IVNTL
Sbjct: 21850 KWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNTL 22029

Query: 1031  PLANQKKLSEPHIFDLKSVTTVSTQSHNQSSVSHED---TDTAPQMLSSKQDFHSN-NLT 1086
              L NQKKLS+P     +S+ TVS  +H QSSV   D   +   PQML SKQDF+SN NLT
Sbjct: 22030 ALDNQKKLSKP-----QSINTVS--AHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLT 22188

Query: 1087  TSQKAEITELSTILEESGSQFEFTQFRKPSHIAQ-NTSEVPGNQMVVLSTASKEWKDTDL 1145
              SQKAEITELSTILEESGSQFEFTQFRKPS+I Q +T EVP NQM +L T S+E +D DL
Sbjct: 22189 PSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADL 22368

Query: 1146  HLPVD-PSVGQTDHSKQFEGSAGVKQSFPHLLEDTCNKNTSCFLPNINEMEFGGFCSALG 1204
             H+ ++ PS+GQ D SKQFEG+  +K+ F  LL++ CNK+ S +L + NE+ F GF SA G
Sbjct: 22369 HVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHG 22548

Query: 1205  TKLSVSNEALRKAMKLFSDIEN-SEEPSAKVGPRGXXXXXXXXXXXXXXKIKKQNTEKSF 1263
             TKL+VS EAL+KA+KLFSDIEN SEE SA+V P                KI+  N +K+ 
Sbjct: 22549 TKLNVSTEALQKAVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHN-DKTV 22725

Query: 1264  DEKSSKCQVTLQNNIEMTTCIFVGRNPEKYIKNTKHEDS-YTSSQRN--NLENSDGSMSS 1320
              EK++KCQ+ LQNNIEMTT  FV    E Y +NT++ED+ YT++ RN  NLE  DGS SS
Sbjct: 22726 SEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLE-FDGSDSS 22902

Query: 1321  TSGPVYIHKGDSDLP-ADQGSKCPESCTQYAREENTQIKENISDLTCLEIMKAEETCM-K 1378
              +  V IHK ++DL   DQ + C +   Q+ +E NTQIKE++SDLT LE+ KA+E C   
Sbjct: 22903 KNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACHGN 23082

Query: 1379  SSDKKQLPSDKMEQNIKEFNIS---FQTASGKNTRVSKESLNKSVNIFNRETDELTVISD 1435
             +S+K+QL + K EQNIK+F  S   FQTASGKN  V+KES NK VN F+++ +EL   + 
Sbjct: 23083 TSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELH--NF 23256

Query: 1436  SLNSKILHGINKDKMHTSCHKKAISIK-KVFEDHFPIVTVSQLPAQQHPEYEIESTKEPT 1494
             SLNS++   I K+KM    +++   +K K+ ++  P+ T +QL   Q      E  KEPT
Sbjct: 23257 SLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPT 23436

Query: 1495  LLSFHTASGKKVKIMQESLDKVKNLFDE-TQYVRKTASFS-QGSKPLK--DSKKELTLAY 1550
             LL FHTASGKKVKI +ESLDKVKNLFDE  Q   +  SFS Q +K LK  ++ K+L LA 
Sbjct: 23437 LLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELAC 23616

Query: 1551  EKIEVTAS-KCEEMQ-------NFVSKETEMLPQ-QNYHMYRQTENLKTSNG--TSSKVQ 1599
             E IE+TA+ KC+EMQ       N VS ET + P+  + ++ RQTENLKTS       KV 
Sbjct: 23617 ETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVH 23796

Query: 1600  ENIENNVEKNPRICCICQSSYPVTEDSALAYYTEDSRKTCVRESSLSKGRKWLREQGDKL 1659
             EN+E    K+P  C   QS Y V E+SALA+YT  SRKT V ++SL + +KWLRE G   
Sbjct: 23797 ENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLRE-GIFD 23973

Query: 1660  GTRNTIKIECVKEHTEDFAGNASYEHSLVIIRTEIDTNHVSENQVSTLLSDPNVCHSYLS 1719
             G    I       +T D+ GN  YE++      E D NH+SE Q      D  + +S +S
Sbjct: 23974 GQPERI-------NTADYVGNYLYENNSNSTIAENDKNHLSEKQ------DTYLSNSSMS 24114

Query: 1720  QSSFCHCDDMHNDSGYFLKNKIDSDVPPDMKNAE---GNTISPRVSATKERNLHPQTINE 1776
              S   H D+++NDSGY  KNK+DS + P +KN E     + S  +S  K+ N +PQT+NE
Sbjct: 24115 NSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNE 24294

Query: 1777  -YCVQKLETNTSPHANKDVAIDPSLLDSRNCKVGSLVF------ITAHSQET-ERTKEIV 1828
               CV++L T++SP  NK+ AI  S+ +S N +VG   F      I   S ET ++ K+I 
Sbjct: 24295 DICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKKVKDIF 24474

Query: 1829  TDNCYKIVEQNRQSKPDTCQT----SCHKVLDDSKDFISPSSSGDVCINSRKDSFCP-HN 1883
             TD+  K++++N ++K   CQT     C++ LDDS+D +  S   D C       F    +
Sbjct: 24475 TDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQS 24654

Query: 1884  EQILQHNQSMSGLKKAA--TP-PVGLETWDTSK-SIREPPQAAHPSRTYGIFSTASGKAI 1939
             E+ILQHNQ+MSGL+K +  +P  V LET D  K SI +  ++   + T GIFSTASGK++
Sbjct: 24655 EEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSANTCGIFSTASGKSV 24834

Query: 1940  QVSDASLEKARQVFSEMDGDAKQLSSMVSLEGNEKPHHSVKRENSVVHSTQGVLSLPKPL 1999
             QVSDASL+ ARQVFSE++   KQ+ S V  + NE      + EN+ + + + ++S     
Sbjct: 24835 QVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLISQKGFS 25014

Query: 2000  PGNVNSSVFSGFSTAGGKLVTVSESALHKVKGMLEEFDLIRTEHTLQHSPIP-EDVSKIL 2058
                VNSS FSGFSTA GK V++ ES+LHKVKG+LEEFDLIRTEH+L +SP   ++VSKIL
Sbjct: 25015 YNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQNVSKIL 25194

Query: 2059  PQPCAEIRTPEYPVNSKLQKTYNDKSSLPSNYK-ESGSSGNTQSIEVSLQLSQMERNQDT 2117
             P+   + R PE+ VNS+++KT + +  L +N   E GSS N  SI+VS  LSQ ++++  
Sbjct: 25195 PR--VDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQ- 25365

Query: 2118  QLVLGTKVS-HSKANLLGKEQTLPQNIKVKTDEMKTFSDVPVKTN--VGEYYSKESENYF 2174
             QLVLGTKVS     ++LGKEQ  P+N+K++  + +TFSDVPVKTN  V   YSK+SENYF
Sbjct: 25366 QLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSENYF 25545

Query: 2175  ETEAVESAKAFMEDDELTDSE-QTHAKCSLFTCPQNE--TLFNSRTRKRGGVTVDAVGQ 2230
             ETEAVE AKAFMEDDELTDS+  +HA  SLFTCP+NE   L NSR  KR G  +  VG+
Sbjct: 25546 ETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILVGK 25722



 Score =  352 bits (903), Expect = 8e-99
 Identities = 203/375 (54%), Positives = 246/375 (65%), Gaps = 5/375 (1%)
 Frame = +1

Query: 257   GLGKMLGDSSGKRNSFKDCLRKPIPNILEDG--ETAVDTSEEDSFSLCFPKRRTRNLQKM 314
             G GK  G+S  K NS KD + K +PN+LED   ET VDTSEEDSFSLCF K RT+NLQK+
Sbjct: 16792 GFGKTSGNSF-KVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKV 16968

Query: 315   RMGKTRKKIFSETRTDELSEEARRQTDDKNSFVFEMELRESDPLDPGVTSQKPFYSQNEE 374
             R  KTRKKIF E   DE  E+++ Q  +K SFV E+E  ++DPLD  V +QKPF S +++
Sbjct: 16969 RTSKTRKKIFHEANADEC-EKSKNQVKEKYSFVSEVEPNDTDPLDSNVANQKPFESGSDK 17145

Query: 375   ICNEAVQCSDSRWSQSNLSGLNETQTGKITLPHISSHSQNISE-DFIDMK-KEGTGSITS 432
             I  E V      WSQ  LSGLN  Q  KI L HISS  QNISE D +D + K     +TS
Sbjct: 17146 ISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTS 17325

Query: 433   EKSLPHISSLPEPEKMFSEETVVDKEHEGQHFESLEDSI-AGKQMVSRTSQAACLSPSIR 491
             E SLP ISSLP+ EK  +EETVV+K  E QH ES  D I A KQ +S TS  A     I+
Sbjct: 17326 ENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIK 17505

Query: 492   KSIFKMREPLDETLGTVFSDSMTNSTFTEEHEASACGLGILTACSQREDSICPSSVDTGS 551
             KSIF++RE   ET    FS  MT+  F +E EAS  GL I T CSQ+EDS+CP+ +D GS
Sbjct: 17506 KSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGS 17685

Query: 552   WPTTLTDTSATVKNAGLISTLKNKKRKFIYSVSDDASLQGKKLQTHRQLELTNLSAQLEA 611
             WP T T  S  +KNAGLISTLK K  KFIY++ D+ S +GKK+   ++ EL N SAQ EA
Sbjct: 17686 WPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEA 17865

Query: 612   SAFEVPLTFTNVNSG 626
             +AFE PLTF N +SG
Sbjct: 17866 NAFEAPLTFANADSG 17910



 Score =  191 bits (485), Expect = 2e-50
 Identities = 94/140 (67%), Positives = 113/140 (80%)
 Frame = +1

Query: 2561  KEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTK 2620
             K++ +R   P+  +    +RYD EID SRRSA+KKI+ERDDTAAKTLVLC+SDIIS S  
Sbjct: 47641 KQWNSRVTLPKICIFVFTFRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSAN 47820

Query: 2621  VSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELV 2680
             +SETS  KTS  D  KV  IELTDGWYAV+AQLDPPL+A++K+G+LTVGQKII  GAELV
Sbjct: 47821 ISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELV 48000

Query: 2681  GSPDACAPLEAPDSLRLKIS 2700
             GSPDAC PLEAP+SL LK++
Sbjct: 48001 GSPDACTPLEAPESLMLKVN 48060



 Score =  156 bits (394), Expect = 9e-40
 Identities = 84/152 (55%), Positives = 101/152 (66%)
 Frame = +3

Query: 3142  SPTGQQSYQSPLSHCTLKGKSMPLAHSAQMAAKSWSGENEIDDPKTCRKRRALDFXXXXX 3201
             SP  +  YQSPLS C  K KS+    SAQM +KS  GE EIDD K C+KRRALDF     
Sbjct: 82689 SPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLP 82868

Query: 3202  XXXXXXXICTFVSPAAQKAFQPPRSCGTKYATPIKKEPSSPRRRTPFQKTSGVSLPDCDS 3261
                    ICTFVSPAAQKAFQPPRSCGTKY TPIKK+  +  + TPF+K + +SL + +S
Sbjct: 82869 LPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNS 83048

Query: 3262  VADEELALLSTQALTPDSVGGNEQAFPGDSTR 3293
             +ADEELAL++TQAL   S G  +     +STR
Sbjct: 83049 IADEELALINTQALLSGSTGEKQFISVSESTR 83144



 Score =  124 bits (312), Expect = 3e-30
 Identities = 68/120 (56%), Positives = 75/120 (62%), Gaps = 31/120 (25%)
 Frame = +1

Query: 2902  KSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFERPSIQLTATKRTQYQQLP--- 2958
             ++ +LSIWRPSSDL SLLTEGKRYRIYHLA SKSKSK ER +IQL ATK+TQYQQLP   
Sbjct: 64264 QTVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVQT 64443

Query: 2959  ----------------------------VSSETLLQVYQPRESLHFSRLSDPAFQPPCSE 2990
                                         VS E L Q+YQPRE LHFS+  DP FQP CSE
Sbjct: 64444 FHCNFSVLISAC*FMESPYVEFLFCFL*VSDEILFQIYQPREPLHFSKFLDPDFQPSCSE 64623



 Score =  118 bits (296), Expect = 2e-28
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +2

Query: 2522  YRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYR 2580
             +RALCDTPGVDPKLIS IWV NHYRWI+WKLAAME AFPKEFANRCL+PERVLLQLKYR
Sbjct: 47039 FRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR 47215



 Score =  112 bits (281), Expect = 1e-26
 Identities = 57/83 (68%), Positives = 67/83 (80%), Gaps = 1/83 (1%)
 Frame = +3

Query: 3004  IGLAPLVYLSDECLNLLVVKFGIDLNEDI-KPRVLIAASNLQCQPESTSGVPTLFACHFS 3062
             +GLAP VYLSDEC NLL +KF IDLNEDI KP +LIAASNLQ +PES SG+ TLFA  FS
Sbjct: 79206 LGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFS 79385

Query: 3063  IFSASPKEAYFQEKVNNLKHAIE 3085
             +FSASPKE +FQE  N +K+ +E
Sbjct: 79386 VFSASPKEGHFQETFNKMKNTVE 79454



 Score =  109 bits (273), Expect = 9e-26
 Identities = 50/63 (79%), Positives = 53/63 (84%)
 Frame = +2

Query: 2461  LYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEE 2520
             LY YGVSK CI +NSKNAE FQF  +D+FGKE L  GKG QLADGGWLIPSNDGKAGKEE
Sbjct: 42263 LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE 42442

Query: 2521  FYR 2523
             FYR
Sbjct: 42443 FYR 42451



 Score =  105 bits (262), Expect = 2e-24
 Identities = 62/129 (48%), Positives = 78/129 (60%), Gaps = 10/129 (7%)
 Frame = +2

Query: 2282  PFCSS-KERQGAQRPHLTSPAQELLSKGHPWRHSALEKSPSSPIVSILPAHDVSATRTER 2340
             P CS+ KERQ  Q P+ T+P QE LSK H + H  LEKS S+  VS  P + VSATR E+
Sbjct: 39371 PHCSTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEK 39550

Query: 2341  TRH---SGKSTKVFVPPFKMKSQFHGDEHFNSKNVNLEGKNQK------STDGDREDGND 2391
              RH   +G+ TKVFVPPFK KS FH  E    +N+NLE   QK       +D  +   ND
Sbjct: 39551 MRHLITTGRPTKVFVPPFKTKSHFHRVEQC-VRNINLEENRQKQNIDGHGSDDSKNKIND 39727

Query: 2392  SHVRQFNKD 2400
             + + QFNK+
Sbjct: 39728 NEIHQFNKN 39754



 Score =  103 bits (256), Expect = 9e-24
 Identities = 52/64 (81%), Positives = 58/64 (90%), Gaps = 1/64 (1%)
 Frame = +1

Query: 2842  FSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAE-KEEGLSRDVTTVWKLRVTSYKKK 2900
             FSEEQLRALNN+RQMLNDKKQA+IQ E RKA+ESAE KE+GLSRDVTTVWKLR+ SY KK
Sbjct: 63844 FSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKK 64023

Query: 2901  EKSA 2904
             EK +
Sbjct: 64024 EKDS 64035



 Score = 90.5 bits (223), Expect = 6e-20
 Identities = 44/76 (57%), Positives = 50/76 (65%)
 Frame = +3

Query: 23   DLGPISLNWFEELXXXXXXXXXXXXXXXXYKPHGYEPQLFKTPQRNPPYHQFASTPIMFK 82
            DLGPISLNWFEEL                +K + YEP LFKTPQR P Y+Q ASTPI+FK
Sbjct: 3597 DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFK 3776

Query: 83   ERSQTLPLDQSPFREL 98
            E+  TLPL QSP +EL
Sbjct: 3777 EQGLTLPLYQSPVKEL 3824



 Score = 88.6 bits (218), Expect = 2e-19
 Identities = 43/64 (67%), Positives = 55/64 (85%)
 Frame = +1

Query: 2400  DLMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPK 2459
             DL++SLQ+ARD+QDMRIK K+R+ +  QPGSLYL K+STLPRISL+AAVG + PSACS K
Sbjct: 40948 DLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHK 41127

Query: 2460  QLYI 2463
             Q+ +
Sbjct: 41128 QVCV 41139



 Score = 82.4 bits (202), Expect = 2e-17
 Identities = 37/50 (74%), Positives = 45/50 (90%)
 Frame = +1

Query: 2749  LQWVEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHE 2798
             LQW+EKT SGLYIFR+EREEEKEA ++ EAQQK+LEALFTK+  EF++HE
Sbjct: 55471 LQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHE 55620



 Score = 54.3 bits (129), Expect = 5e-09
 Identities = 25/36 (69%), Positives = 31/36 (86%)
 Frame = +2

Query: 2228  VGQPPIKRSLLNEFDRIIESKGKSLTPSKSTPDGTV 2263
             +G+P IKR+LLNEFDRIIE++ KSL  SKSTPDG +
Sbjct: 29075 LGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGKI 29182



 Score = 53.1 bits (126), Expect = 1e-08
 Identities = 27/41 (65%), Positives = 33/41 (80%)
 Frame = +2

Query: 2799  EDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLE 2839
             E+TT+  + SR LTRQQV ALQDGAELY AV+ A+DP +LE
Sbjct: 61190 ENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLE 61312



 Score = 50.1 bits (118), Expect = 9e-08
 Identities = 24/37 (64%), Positives = 29/37 (78%)
 Frame = +2

Query: 221   LKSCFSNHNESPQKNDRSVPSVIDSENKNQQEAFSQG 257
             +KS FSNH+ES +KNDR + SV DSEN NQ+EA S G
Sbjct: 15443 VKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHG 15553



 Score = 48.9 bits (115), Expect = 2e-07
 Identities = 21/38 (55%), Positives = 25/38 (65%)
 Frame = +2

Query: 3086  NIDTFYKEAEKKLIHVLEGDSPKWSTPNKDPTREPHAA 3123
             NID    EAE KL+H+L  + PKWSTP KD T  P+ A
Sbjct: 81419 NIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTA 81532



 Score = 48.9 bits (115), Expect = 2e-07
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +2

Query: 2697  LKISANSTRPARWHSXXXXXXXXXXXXXXXXXXXXXXXNVGCVDIIVQRVYPLQ 2750
             ++ISANSTRPARW++                       NVGCVD+I+QR YP+Q
Sbjct: 54917 VQISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPIQ 55078



 Score = 44.3 bits (103), Expect = 5e-06
 Identities = 21/41 (51%), Positives = 23/41 (56%)
 Frame = +1

Query: 167   QTPKPISESLGVEVDPDMSWXXXXXXXXXXXXXVLIARDEE 207
             QTPK ISESLG EVDPDMSW             VLI  + +
Sbjct: 11026 QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGNNSK 11148



 Score = 43.9 bits (102), Expect = 6e-06
 Identities = 17/23 (73%), Positives = 20/23 (86%)
 Frame = +3

Query: 2261  GTVKDRSLFTHHMSLEPVTCGPF 2283
             GT+KDR LF HH+SLEP+TC PF
Sbjct: 31347 GTIKDRRLFMHHVSLEPITCVPF 31415



 Score = 35.0 bits (79), Expect = 0.003
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +1

Query: 1    MPVEYKRRPTFWEIFKARCSTADL 24
            MP+  K RPTF+EIFK RC+ A +
Sbjct: 982  MPIGSKERPTFFEIFKTRCNKAGI 1053



 Score = 25.0 bits (53), Expect = 3.0
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -2

Query: 3126  CCASDLLGSGGQFLRISPTGQQSYQSPLSHCT 3157
             C  S LLGS  Q  R++P G+   +    HCT
Sbjct: 12908 CL*SQLLGSLRQENRLNPEGRGCCEPRWCHCT 12813



 Score = 25.0 bits (53), Expect = 3.0
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 151   PVVSGSLFYTPK 162
             PVV GSLF+TPK
Sbjct: 10759 PVVCGSLFHTPK 10794



 Score = 24.6 bits (52), Expect = 3.9
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = -3

Query: 2877  EKEEGLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSS 2917
             E E  +SRD TT  +    S    +KS ++  ++PSS L S
Sbjct: 44971 EVEAAVSRDCTTALQPEQ*SETVSKKSQIMLPFKPSSGLFS 44849


Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 293,769
Number of Sequences: 0
Number of extensions: 4218
Number of successful extensions: 87
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of query: 3329
length of database: 28,063
effective HSP length: 78
effective length of query: 3251
effective length of database: 27,985
effective search space: 90979235
effective search space used: 90979235
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)

END